Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 8118..8382 | Replicon | plasmid pMPTEM-30 |
| Accession | NZ_CP043947 | ||
| Organism | Escherichia coli strain AR202.2 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | F3P13_RS23440 | Protein ID | WP_001303307.1 |
| Coordinates | 8230..8382 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 8118..8180 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F3P13_RS23425 | 3357..5648 | - | 2292 | WP_001289275.1 | hypothetical protein | - |
| F3P13_RS23430 | 5641..6711 | - | 1071 | WP_000151576.1 | IncI1-type conjugal transfer protein TrbB | - |
| F3P13_RS23435 | 6730..7938 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - | 8118..8180 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 8118..8180 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 8118..8180 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 8118..8180 | - | 63 | NuclAT_0 | - | Antitoxin |
| F3P13_RS23440 | 8230..8382 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| F3P13_RS23445 | 8454..8705 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| F3P13_RS25495 | 9365..9502 | - | 138 | WP_047088497.1 | hypothetical protein | - |
| F3P13_RS23450 | 9547..10773 | - | 1227 | WP_024186316.1 | transposase | - |
| F3P13_RS23455 | 10832..11236 | + | 405 | WP_001175009.1 | IS200/IS605 family transposase | - |
| F3P13_RS23460 | 11568..11777 | - | 210 | WP_032178830.1 | hemolysin expression modulator Hha | - |
| F3P13_RS23465 | 11875..12537 | - | 663 | WP_000644794.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / floR / blaTEM-30 / sul1 / qacE / ant(3'')-Ia / dfrA1 | - | 1..115932 | 115932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T139601 WP_001303307.1 NZ_CP043947:8230-8382 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T139601 NZ_CP058748:c2710912-2710810 [Escherichia coli]
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 63 bp
>AT139601 NZ_CP043947:c8180-8118 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|