Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1374308..1374529 | Replicon | chromosome |
Accession | NZ_CP043937 | ||
Organism | Escherichia coli strain RM14516 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
Locus tag | FS841_RS06505 | Protein ID | WP_000176713.1 |
Coordinates | 1374308..1374415 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1374463..1374529 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FS841_RS06480 (1370153) | 1370153..1371235 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
FS841_RS06485 (1371235) | 1371235..1372068 | + | 834 | WP_000456458.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
FS841_RS06490 (1372065) | 1372065..1372457 | + | 393 | WP_000151883.1 | invasion regulator SirB2 | - |
FS841_RS06495 (1372461) | 1372461..1373270 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
FS841_RS06500 (1373306) | 1373306..1374160 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
FS841_RS06505 (1374308) | 1374308..1374415 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_27 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_27 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_27 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_27 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_29 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_29 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_29 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_29 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_31 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_31 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_31 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_31 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_33 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_33 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_33 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_33 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_35 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_35 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_35 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_35 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_37 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_37 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_37 | - | - |
- (1374465) | 1374465..1374528 | + | 64 | NuclAT_37 | - | - |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_14 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_14 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_14 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_14 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_16 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_16 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_16 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_16 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_18 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_18 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_18 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_18 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_20 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_20 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_20 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_20 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_22 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_22 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_22 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_22 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_24 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_24 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_24 | - | Antitoxin |
- (1374463) | 1374463..1374529 | + | 67 | NuclAT_24 | - | Antitoxin |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_39 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_39 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_39 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_39 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_41 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_41 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_41 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_41 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_43 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_43 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_43 | - | - |
- (1374465) | 1374465..1374530 | + | 66 | NuclAT_43 | - | - |
FS841_RS06510 (1374843) | 1374843..1374950 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_26 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_26 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_26 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_26 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_28 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_28 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_28 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_28 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_30 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_30 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_30 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_30 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_32 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_32 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_32 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_32 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_34 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_34 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_34 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_34 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_36 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_36 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_36 | - | - |
- (1375003) | 1375003..1375064 | + | 62 | NuclAT_36 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_15 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_15 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_15 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_15 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_17 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_17 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_17 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_17 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_19 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_19 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_19 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_19 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_21 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_21 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_21 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_21 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_23 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_23 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_23 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_23 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_25 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_25 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_25 | - | - |
- (1375003) | 1375003..1375065 | + | 63 | NuclAT_25 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_38 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_38 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_38 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_38 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_40 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_40 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_40 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_40 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_42 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_42 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_42 | - | - |
- (1375003) | 1375003..1375066 | + | 64 | NuclAT_42 | - | - |
FS841_RS06515 (1375356) | 1375356..1376456 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
FS841_RS06520 (1376726) | 1376726..1376956 | + | 231 | WP_001146450.1 | putative cation transport regulator ChaB | - |
FS841_RS06525 (1377114) | 1377114..1377809 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
FS841_RS06530 (1377853) | 1377853..1378206 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T139513 WP_000176713.1 NZ_CP043937:c1374415-1374308 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T139513 NZ_CP058719:c117121-116786 [Escherichia coli]
ATGGTAAGCCGATACGTACCCGATATGGGCGATCTGATTTGGGTTGATTTTGACCCGACAAAAGGTAGCGAGCAAGCTGG
ACATCGTCCAGCTGTTGTCCTGAGTCCTTTCATGTACAACAACAAAACAGGTATGTGTCTGTGTGTTCCTTGTACAACGC
AATCAAAAGGATATCCGTTCGAAGTTGTTTTATCCGGTCAGGAACGTGATGGCGTAGCGTTAGCTGATCAGGTAAAAAGT
ATCGCCTGGCGGGCAAGAGGAGCAACGAAGAAAGGAACAGTTGCCCCAGAGGAATTACAACTCATTAAAGCCAAAATTAA
CGTACTGATTGGGTAG
ATGGTAAGCCGATACGTACCCGATATGGGCGATCTGATTTGGGTTGATTTTGACCCGACAAAAGGTAGCGAGCAAGCTGG
ACATCGTCCAGCTGTTGTCCTGAGTCCTTTCATGTACAACAACAAAACAGGTATGTGTCTGTGTGTTCCTTGTACAACGC
AATCAAAAGGATATCCGTTCGAAGTTGTTTTATCCGGTCAGGAACGTGATGGCGTAGCGTTAGCTGATCAGGTAAAAAGT
ATCGCCTGGCGGGCAAGAGGAGCAACGAAGAAAGGAACAGTTGCCCCAGAGGAATTACAACTCATTAAAGCCAAAATTAA
CGTACTGATTGGGTAG
Antitoxin
Download Length: 67 bp
>AT139513 NZ_CP043937:1374463-1374529 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|