Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 405177..405361 | Replicon | chromosome |
Accession | NZ_CP043843 | ||
Organism | Staphylococcus aureus strain NCCP 16830 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | F1612_RS01895 | Protein ID | WP_000482647.1 |
Coordinates | 405177..405284 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 405301..405361 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F1612_RS01870 | 400539..401012 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
F1612_RS01875 | 401135..402346 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
F1612_RS01880 | 402528..403187 | - | 660 | WP_000831298.1 | membrane protein | - |
F1612_RS01885 | 403247..404389 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
F1612_RS01890 | 404657..405043 | + | 387 | WP_000779360.1 | flippase GtxA | - |
F1612_RS01895 | 405177..405284 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 405301..405361 | - | 61 | - | - | Antitoxin |
F1612_RS01900 | 405932..407695 | + | 1764 | WP_045172654.1 | ABC transporter ATP-binding protein/permease | - |
F1612_RS01905 | 407720..409453 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
F1612_RS01910 | 409684..409851 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T139348 WP_000482647.1 NZ_CP043843:405177-405284 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T139348 NZ_CP058652:c29408-29256 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT139348 NZ_CP043843:c405361-405301 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|