Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 28132..28396 | Replicon | plasmid p2RM8082 |
| Accession | NZ_CP043828 | ||
| Organism | Escherichia coli strain RM8082 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | F1745_RS26465 | Protein ID | WP_001303307.1 |
| Coordinates | 28132..28284 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 28334..28396 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F1745_RS26440 (23335) | 23335..25503 | + | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
| F1745_RS26445 (25579) | 25579..26193 | + | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| F1745_RS26450 (26291) | 26291..26500 | + | 210 | WP_238014315.1 | hemolysin expression modulator Hha | - |
| F1745_RS26455 (26709) | 26709..26885 | + | 177 | WP_001054900.1 | hypothetical protein | - |
| - (27371) | 27371..27422 | + | 52 | NuclAT_2 | - | - |
| - (27371) | 27371..27422 | + | 52 | NuclAT_2 | - | - |
| - (27371) | 27371..27422 | + | 52 | NuclAT_2 | - | - |
| - (27371) | 27371..27422 | + | 52 | NuclAT_2 | - | - |
| F1745_RS26460 (27809) | 27809..28060 | + | 252 | WP_001291965.1 | hypothetical protein | - |
| F1745_RS26465 (28132) | 28132..28284 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - (28334) | 28334..28396 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (28334) | 28334..28396 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (28334) | 28334..28396 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (28334) | 28334..28396 | + | 63 | NuclAT_0 | - | Antitoxin |
| F1745_RS26470 (28605) | 28605..29690 | + | 1086 | WP_000080543.1 | protein finQ | - |
| - (29757) | 29757..29817 | + | 61 | NuclAT_1 | - | - |
| - (29757) | 29757..29817 | + | 61 | NuclAT_1 | - | - |
| - (29757) | 29757..29817 | + | 61 | NuclAT_1 | - | - |
| - (29757) | 29757..29817 | + | 61 | NuclAT_1 | - | - |
| F1745_RS26475 (29997) | 29997..31205 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| F1745_RS26480 (31224) | 31224..32294 | + | 1071 | WP_000151592.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..97743 | 97743 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T139333 WP_001303307.1 NZ_CP043828:c28284-28132 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T139333 NZ_CP043828:c28284-28132 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT139333 NZ_CP043828:28334-28396 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
