Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 3972158..3972377 Replicon chromosome
Accession NZ_CP043825
Organism Escherichia coli strain RM8082

Toxin (Protein)


Gene name ldrD Uniprot ID S1E8T8
Locus tag F1745_RS19810 Protein ID WP_000141634.1
Coordinates 3972158..3972265 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 3972314..3972377 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F1745_RS19780 (3967210) 3967210..3967398 - 189 WP_001063318.1 cellulose biosynthesis protein BcsR -
F1745_RS19785 (3967671) 3967671..3969242 + 1572 WP_001204906.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
F1745_RS19790 (3969239) 3969239..3969430 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
F1745_RS19795 (3969427) 3969427..3971106 + 1680 WP_000191590.1 cellulose biosynthesis protein BcsG -
F1745_RS19800 (3971192) 3971192..3971299 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3971348) 3971348..3971411 + 64 NuclAT_21 - -
- (3971348) 3971348..3971411 + 64 NuclAT_21 - -
- (3971348) 3971348..3971411 + 64 NuclAT_21 - -
- (3971348) 3971348..3971411 + 64 NuclAT_21 - -
- (3971348) 3971348..3971411 + 64 NuclAT_24 - -
- (3971348) 3971348..3971411 + 64 NuclAT_24 - -
- (3971348) 3971348..3971411 + 64 NuclAT_24 - -
- (3971348) 3971348..3971411 + 64 NuclAT_24 - -
- (3971348) 3971348..3971411 + 64 NuclAT_27 - -
- (3971348) 3971348..3971411 + 64 NuclAT_27 - -
- (3971348) 3971348..3971411 + 64 NuclAT_27 - -
- (3971348) 3971348..3971411 + 64 NuclAT_27 - -
- (3971348) 3971348..3971411 + 64 NuclAT_30 - -
- (3971348) 3971348..3971411 + 64 NuclAT_30 - -
- (3971348) 3971348..3971411 + 64 NuclAT_30 - -
- (3971348) 3971348..3971411 + 64 NuclAT_30 - -
- (3971348) 3971348..3971413 + 66 NuclAT_15 - -
- (3971348) 3971348..3971413 + 66 NuclAT_15 - -
- (3971348) 3971348..3971413 + 66 NuclAT_15 - -
- (3971348) 3971348..3971413 + 66 NuclAT_15 - -
- (3971348) 3971348..3971413 + 66 NuclAT_18 - -
- (3971348) 3971348..3971413 + 66 NuclAT_18 - -
- (3971348) 3971348..3971413 + 66 NuclAT_18 - -
- (3971348) 3971348..3971413 + 66 NuclAT_18 - -
F1745_RS19805 (3971675) 3971675..3971782 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3971839) 3971839..3971894 + 56 NuclAT_22 - -
- (3971839) 3971839..3971894 + 56 NuclAT_22 - -
- (3971839) 3971839..3971894 + 56 NuclAT_22 - -
- (3971839) 3971839..3971894 + 56 NuclAT_22 - -
- (3971839) 3971839..3971894 + 56 NuclAT_25 - -
- (3971839) 3971839..3971894 + 56 NuclAT_25 - -
- (3971839) 3971839..3971894 + 56 NuclAT_25 - -
- (3971839) 3971839..3971894 + 56 NuclAT_25 - -
- (3971839) 3971839..3971894 + 56 NuclAT_28 - -
- (3971839) 3971839..3971894 + 56 NuclAT_28 - -
- (3971839) 3971839..3971894 + 56 NuclAT_28 - -
- (3971839) 3971839..3971894 + 56 NuclAT_28 - -
- (3971839) 3971839..3971894 + 56 NuclAT_31 - -
- (3971839) 3971839..3971894 + 56 NuclAT_31 - -
- (3971839) 3971839..3971894 + 56 NuclAT_31 - -
- (3971839) 3971839..3971894 + 56 NuclAT_31 - -
- (3971839) 3971839..3971896 + 58 NuclAT_16 - -
- (3971839) 3971839..3971896 + 58 NuclAT_16 - -
- (3971839) 3971839..3971896 + 58 NuclAT_16 - -
- (3971839) 3971839..3971896 + 58 NuclAT_16 - -
- (3971839) 3971839..3971896 + 58 NuclAT_19 - -
- (3971839) 3971839..3971896 + 58 NuclAT_19 - -
- (3971839) 3971839..3971896 + 58 NuclAT_19 - -
- (3971839) 3971839..3971896 + 58 NuclAT_19 - -
F1745_RS19810 (3972158) 3972158..3972265 - 108 WP_000141634.1 type I toxin-antitoxin system toxic polypeptide LdrD Toxin
- (3972314) 3972314..3972377 + 64 NuclAT_20 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_20 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_20 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_20 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_23 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_23 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_23 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_23 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_26 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_26 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_26 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_26 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_29 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_29 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_29 - Antitoxin
- (3972314) 3972314..3972377 + 64 NuclAT_29 - Antitoxin
- (3972314) 3972314..3972379 + 66 NuclAT_14 - -
- (3972314) 3972314..3972379 + 66 NuclAT_14 - -
- (3972314) 3972314..3972379 + 66 NuclAT_14 - -
- (3972314) 3972314..3972379 + 66 NuclAT_14 - -
- (3972314) 3972314..3972379 + 66 NuclAT_17 - -
- (3972314) 3972314..3972379 + 66 NuclAT_17 - -
- (3972314) 3972314..3972379 + 66 NuclAT_17 - -
- (3972314) 3972314..3972379 + 66 NuclAT_17 - -
F1745_RS19815 (3972741) 3972741..3974012 + 1272 WP_001402620.1 aromatic amino acid transport family protein -
F1745_RS19820 (3974042) 3974042..3975046 - 1005 WP_000107030.1 dipeptide ABC transporter ATP-binding subunit DppF -
F1745_RS19825 (3975043) 3975043..3976026 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
F1745_RS19830 (3976037) 3976037..3976939 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3916.72 Da        Isoelectric Point: 9.0157

>T139318 WP_000141634.1 NZ_CP043825:c3972265-3972158 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T139318 NZ_CP058638:1491562-1491810 [Rhodococcus sp. ZPP]
ATGACTGCAATAACAGCCACCGAGGCCAGGAAGAACCTGTTCGGCTTGGTCAGCCAAGTGAACAAGGACCACACAACCGT
GGAAATAGTCTCCAAGAACGGGAACGCTGTTCTTCTCTCGAAGGACGACTACGACTCCATCATGGAAACGGCCTACCTGC
TGTCCAGCCCGGCGAACGCTCGCCGCCTGTTTCGCAGTCTGGAGGCAACCCGGCGCGGTGAATACACCGAAAGGGAACTG
ATCGAGTGA

Antitoxin


Download         Length: 64 bp

>AT139318 NZ_CP043825:3972314-3972377 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
PDB 5LBJ

Antitoxin

Download structure file

References