Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 42423..42677 | Replicon | plasmid p2RM10740 |
| Accession | NZ_CP043823 | ||
| Organism | Escherichia coli strain RM10740 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A1D7QA06 |
| Locus tag | F1748_RS25555 | Protein ID | WP_001367749.1 |
| Coordinates | 42423..42572 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 42616..42677 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F1748_RS26590 (37810) | 37810..38157 | - | 348 | WP_265345030.1 | DUF262 domain-containing protein | - |
| F1748_RS25520 (38442) | 38442..38843 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| F1748_RS25525 (38776) | 38776..39033 | - | 258 | WP_023981775.1 | type II toxin-antitoxin system antitoxin PemI | - |
| F1748_RS25530 (39126) | 39126..39779 | - | 654 | WP_089516292.1 | type II CAAX endopeptidase family protein | - |
| F1748_RS25535 (40720) | 40720..41577 | - | 858 | WP_122986602.1 | incFII family plasmid replication initiator RepA | - |
| F1748_RS25540 (41570) | 41570..41644 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| F1748_RS25545 (41693) | 41693..41818 | + | 126 | WP_001436741.1 | hypothetical protein | - |
| F1748_RS25550 (41891) | 41891..42139 | - | 249 | WP_000083838.1 | replication regulatory protein RepA | - |
| F1748_RS25555 (42423) | 42423..42572 | - | 150 | WP_001367749.1 | Hok/Gef family protein | Toxin |
| - (42616) | 42616..42677 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (42616) | 42616..42677 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (42616) | 42616..42677 | + | 62 | NuclAT_0 | - | Antitoxin |
| - (42616) | 42616..42677 | + | 62 | NuclAT_0 | - | Antitoxin |
| F1748_RS25560 (42936) | 42936..43235 | - | 300 | WP_050593763.1 | hypothetical protein | - |
| F1748_RS25565 (43353) | 43353..43800 | - | 448 | Protein_47 | thermonuclease family protein | - |
| F1748_RS25570 (44543) | 44543..44746 | - | 204 | WP_001327131.1 | hypothetical protein | - |
| F1748_RS25575 (44901) | 44901..45458 | - | 558 | WP_089516209.1 | fertility inhibition protein FinO | - |
| F1748_RS25580 (45561) | 45561..46421 | - | 861 | WP_089516206.1 | alpha/beta hydrolase | - |
| F1748_RS25585 (46480) | 46480..47226 | - | 747 | WP_032285008.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..100386 | 100386 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5528.64 Da Isoelectric Point: 8.7678
>T139286 WP_001367749.1 NZ_CP043823:c42572-42423 [Escherichia coli]
MTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGVLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T139286 NZ_CP043823:c42572-42423 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGGTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGGTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT139286 NZ_CP043823:42616-42677 [Escherichia coli]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|