Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 49170..49409 | Replicon | plasmid pNMBU-W13E19_01 |
Accession | NZ_CP043407 | ||
Organism | Escherichia coli strain NMBU-W13E19 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A762TWR7 |
Locus tag | FZN32_RS25015 | Protein ID | WP_023144756.1 |
Coordinates | 49170..49304 (-) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 49349..49409 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FZN32_RS24980 | 44756..44896 | - | 141 | Protein_58 | DUF262 domain-containing protein | - |
FZN32_RS24985 | 45181..45582 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
FZN32_RS24990 | 45515..45772 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
FZN32_RS24995 | 45865..46518 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
FZN32_RS25000 | 47458..48315 | - | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
FZN32_RS25005 | 48308..48382 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
FZN32_RS25010 | 48619..48873 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
FZN32_RS25015 | 49170..49304 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 49349..49409 | + | 61 | NuclAT_1 | - | Antitoxin |
- | 49349..49409 | + | 61 | NuclAT_1 | - | Antitoxin |
- | 49349..49409 | + | 61 | NuclAT_1 | - | Antitoxin |
- | 49349..49409 | + | 61 | NuclAT_1 | - | Antitoxin |
FZN32_RS25020 | 49376..49662 | - | 287 | Protein_66 | DUF2726 domain-containing protein | - |
FZN32_RS25025 | 50175..50387 | - | 213 | WP_013023861.1 | hypothetical protein | - |
FZN32_RS25030 | 50518..51078 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
FZN32_RS25035 | 51133..51879 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / dfrA14 / mph(A) | - | 1..122112 | 122112 | |
- | flank | IS/Tn | - | - | 44003..44380 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T138701 WP_023144756.1 NZ_CP043407:c49304-49170 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T138701 NZ_CP043407:c49304-49170 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT138701 NZ_CP043407:49349-49409 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|