Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2096428..2096727 | Replicon | chromosome |
Accession | NZ_CP043392 | ||
Organism | Staphylococcus aureus strain NRS384-rpoB-H481N-NCV |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | FZC50_RS10680 | Protein ID | WP_011447039.1 |
Coordinates | 2096551..2096727 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2096428..2096483 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FZC50_RS10635 | 2091759..2092019 | + | 261 | WP_001791826.1 | hypothetical protein | - |
FZC50_RS10640 | 2092072..2092422 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
FZC50_RS10645 | 2093107..2093556 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
FZC50_RS10650 | 2093651..2093986 | - | 336 | Protein_2007 | SH3 domain-containing protein | - |
FZC50_RS10660 | 2094636..2095127 | - | 492 | WP_000919350.1 | staphylokinase | - |
FZC50_RS10665 | 2095318..2096073 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
FZC50_RS10670 | 2096085..2096339 | - | 255 | WP_000611512.1 | phage holin | - |
FZC50_RS10675 | 2096391..2096498 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2096420..2096559 | + | 140 | NuclAT_0 | - | - |
- | 2096420..2096559 | + | 140 | NuclAT_0 | - | - |
- | 2096420..2096559 | + | 140 | NuclAT_0 | - | - |
- | 2096420..2096559 | + | 140 | NuclAT_0 | - | - |
- | 2096428..2096483 | + | 56 | - | - | Antitoxin |
FZC50_RS10680 | 2096551..2096727 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
FZC50_RS10685 | 2096877..2097173 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
FZC50_RS10690 | 2097231..2097518 | - | 288 | WP_001040261.1 | hypothetical protein | - |
FZC50_RS10695 | 2097565..2097717 | - | 153 | WP_001153681.1 | hypothetical protein | - |
FZC50_RS10700 | 2097707..2101492 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb | 2092072..2137071 | 44999 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T138608 WP_011447039.1 NZ_CP043392:c2096727-2096551 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T138608 NZ_CP043392:c2096727-2096551 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT138608 NZ_CP043392:2096428-2096483 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|