Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1935438..1935620 | Replicon | chromosome |
| Accession | NZ_CP043392 | ||
| Organism | Staphylococcus aureus strain NRS384-rpoB-H481N-NCV | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | FZC50_RS09635 | Protein ID | WP_001801861.1 |
| Coordinates | 1935438..1935533 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1935561..1935620 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FZC50_RS09585 | 1931098..1931724 | + | 627 | Protein_1845 | hypothetical protein | - |
| FZC50_RS09590 | 1931765..1932109 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| FZC50_RS09595 | 1932207..1932758 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| FZC50_RS09600 | 1932976..1933617 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FZC50_RS09605 | 1933731..1933916 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| FZC50_RS09610 | 1933918..1934094 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| FZC50_RS09615 | 1934105..1934488 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| FZC50_RS09625 | 1935092..1935235 | - | 144 | WP_001549059.1 | transposase | - |
| FZC50_RS09635 | 1935438..1935533 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1935561..1935620 | - | 60 | - | - | Antitoxin |
| FZC50_RS09640 | 1935656..1935757 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| FZC50_RS09645 | 1935735..1935911 | - | 177 | Protein_1855 | transposase | - |
| FZC50_RS09650 | 1936105..1936482 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1905073..2010180 | 105107 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T138605 WP_001801861.1 NZ_CP043392:1935438-1935533 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T138605 NZ_CP043392:1935438-1935533 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT138605 NZ_CP043392:c1935620-1935561 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|