Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 153623..153876 | Replicon | plasmid pKPC2_020120 |
| Accession | NZ_CP043358 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain WCHKP020120 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | CLQ78_RS27855 | Protein ID | WP_001312851.1 |
| Coordinates | 153727..153876 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 153623..153682 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CLQ78_RS27815 (149283) | 149283..149348 | - | 66 | Protein_193 | helix-turn-helix domain-containing protein | - |
| CLQ78_RS27820 (149401) | 149401..150105 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| CLQ78_RS27825 (150130) | 150130..150330 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| CLQ78_RS27830 (150350) | 150350..151096 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| CLQ78_RS27835 (151151) | 151151..151711 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| CLQ78_RS27840 (151843) | 151843..152043 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| CLQ78_RS27845 (152429) | 152429..153028 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| CLQ78_RS27850 (153090) | 153090..153422 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (153623) | 153623..153682 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (153623) | 153623..153682 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (153623) | 153623..153682 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (153623) | 153623..153682 | - | 60 | NuclAT_1 | - | Antitoxin |
| CLQ78_RS27855 (153727) | 153727..153876 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| CLQ78_RS27860 (154160) | 154160..154408 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| CLQ78_RS29335 (154523) | 154523..154707 | + | 185 | Protein_203 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..154719 | 154719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T138510 WP_001312851.1 NZ_CP043358:153727-153876 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T138510 NZ_CP058128:c2795869-2795766 [Enterobacter hormaechei]
GGCAAGGCGATTGAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGATTGAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 60 bp
>AT138510 NZ_CP043358:c153682-153623 [Klebsiella pneumoniae subsp. pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|