Detailed information of TA system TA138506

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 40629..40898
• Replicon: plasmid pKPC2_020120
• Accession: NZ_CP043358
• Organism: Klebsiella pneumoniae subsp. pneumoniae strain WCHKP020120

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: CLQ78_RS27135
• Protein ID: WP_001372321.1
• Coordinates: 40773..40898 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	40629..40694 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CLQ78_RS27110	36339..36866	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
CLQ78_RS27115	36924..37157	+	234	WP_000006003.1	DUF905 family protein	-
CLQ78_RS27120	37218..39241	+	2024	Protein_49	ParB/RepB/Spo0J family partition protein	-
CLQ78_RS27125	39310..39744	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
CLQ78_RS27130	39741..40460	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	40472..40696	+	225	NuclAT_0	-	-
-	40472..40696	+	225	NuclAT_0	-	-
-	40472..40696	+	225	NuclAT_0	-	-
-	40472..40696	+	225	NuclAT_0	-	-
-	40629..40694	+	66	-	-	Antitoxin
CLQ78_RS29310	40682..40831	+	150	Protein_52	plasmid maintenance protein Mok	-
CLQ78_RS27135	40773..40898	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
CLQ78_RS27140	41217..41513	-	297	Protein_54	hypothetical protein	-
CLQ78_RS27145	41813..42109	+	297	WP_001272251.1	hypothetical protein	-
CLQ78_RS27150	42220..43041	+	822	WP_001234445.1	DUF932 domain-containing protein	-
CLQ78_RS27155	43338..43985	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
CLQ78_RS27160	44262..44645	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
CLQ78_RS27165	44836..45522	+	687	WP_015059009.1	PAS domain-containing protein	-
CLQ78_RS27170	45616..45843	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB	-	1..154719	154719

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T138506 WP_001372321.1 NZ_CP043358:40773-40898 [Klebsiella pneumoniae subsp. pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T138506 NZ_CP043358:40773-40898 [Klebsiella pneumoniae subsp. pneumoniae]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT138506 NZ_CP043358:40629-40694 [Klebsiella pneumoniae subsp. pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin