Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 49267..49536 | Replicon | plasmid p3_115106 |
| Accession | NZ_CP043338 | ||
| Organism | Escherichia coli strain WCHEC115106 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | FZC46_RS25260 | Protein ID | WP_001372321.1 |
| Coordinates | 49411..49536 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 49267..49332 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FZC46_RS25220 | 44269..44511 | + | 243 | WP_001365577.1 | hypothetical protein | - |
| FZC46_RS25225 | 44981..45508 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| FZC46_RS25230 | 45564..45797 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| FZC46_RS25235 | 45856..47879 | + | 2024 | Protein_56 | ParB/RepB/Spo0J family partition protein | - |
| FZC46_RS25240 | 47948..48382 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| FZC46_RS25245 | 48379..49141 | + | 763 | Protein_58 | plasmid SOS inhibition protein A | - |
| - | 49110..49334 | + | 225 | NuclAT_0 | - | - |
| - | 49110..49334 | + | 225 | NuclAT_0 | - | - |
| - | 49110..49334 | + | 225 | NuclAT_0 | - | - |
| - | 49110..49334 | + | 225 | NuclAT_0 | - | - |
| FZC46_RS25250 | 49119..49298 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 49267..49332 | + | 66 | - | - | Antitoxin |
| FZC46_RS25255 | 49320..49469 | + | 150 | Protein_60 | plasmid maintenance protein Mok | - |
| FZC46_RS25260 | 49411..49536 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| FZC46_RS25265 | 49855..50151 | - | 297 | Protein_62 | hypothetical protein | - |
| FZC46_RS25270 | 50451..50747 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| FZC46_RS25275 | 50858..51679 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| FZC46_RS25280 | 51976..52566 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
| FZC46_RS25285 | 52901..53284 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| FZC46_RS25290 | 53478..54149 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| FZC46_RS25295 | 54286..54513 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T138403 WP_001372321.1 NZ_CP043338:49411-49536 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T138403 NZ_CP043338:49411-49536 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT138403 NZ_CP043338:49267-49332 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|