Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 91207..91633 | Replicon | plasmid p1_115106 |
Accession | NZ_CP043336 | ||
Organism | Escherichia coli strain WCHEC115106 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | FZC46_RS24150 | Protein ID | WP_001372321.1 |
Coordinates | 91207..91332 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 91409..91633 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FZC46_RS24110 (86576) | 86576..87265 | - | 690 | WP_039002187.1 | conjugal transfer transcriptional regulator TraJ | - |
FZC46_RS24115 (87452) | 87452..87835 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
FZC46_RS24120 (88156) | 88156..88758 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
FZC46_RS24125 (89055) | 89055..89876 | - | 822 | WP_072795862.1 | DUF932 domain-containing protein | - |
FZC46_RS24130 (89998) | 89998..90285 | - | 288 | WP_000107535.1 | hypothetical protein | - |
FZC46_RS24135 (90310) | 90310..90516 | - | 207 | WP_000547968.1 | hypothetical protein | - |
FZC46_RS24140 (90586) | 90586..90759 | + | 174 | Protein_104 | hypothetical protein | - |
FZC46_RS24145 (90757) | 90757..90987 | - | 231 | WP_001426396.1 | hypothetical protein | - |
FZC46_RS24150 (91207) | 91207..91332 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FZC46_RS24155 (91274) | 91274..91423 | - | 150 | Protein_107 | plasmid maintenance protein Mok | - |
- (91409) | 91409..91633 | - | 225 | NuclAT_0 | - | Antitoxin |
- (91409) | 91409..91633 | - | 225 | NuclAT_0 | - | Antitoxin |
- (91409) | 91409..91633 | - | 225 | NuclAT_0 | - | Antitoxin |
- (91409) | 91409..91633 | - | 225 | NuclAT_0 | - | Antitoxin |
FZC46_RS24160 (91445) | 91445..91633 | + | 189 | WP_001299721.1 | hypothetical protein | - |
FZC46_RS24165 (91602) | 91602..92364 | - | 763 | Protein_109 | plasmid SOS inhibition protein A | - |
FZC46_RS24170 (92361) | 92361..92795 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
FZC46_RS24175 (92850) | 92850..94808 | - | 1959 | WP_241420247.1 | ParB/RepB/Spo0J family partition protein | - |
FZC46_RS24180 (94873) | 94873..95106 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
FZC46_RS24185 (95163) | 95163..95702 | - | 540 | WP_032332913.1 | single-stranded DNA-binding protein | - |
FZC46_RS24190 (95728) | 95728..95934 | - | 207 | WP_000275853.1 | hypothetical protein | - |
FZC46_RS24195 (96175) | 96175..96402 | - | 228 | WP_071961421.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / tet(A) / lnu(F) / blaTEM-1B / sul3 / aph(3')-Ia / aac(3)-IId | - | 1..133446 | 133446 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T138398 WP_001372321.1 NZ_CP043336:c91332-91207 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T138398 NZ_CP057681:3776925-3777077 [Escherichia fergusonii]
ATGCTGACAAAATATGCCCTTGTGGCAATCATCGTACTGTGTTGTACAGTACTGGGATTCACGCTGATGGTAGGCGACTC
GTTGTGTGAGTTGAGTATCAGAGAACGTGGTATGGAGTTTAAGGCAGTTCTCGCTTACGAATCGAAGAAGTAG
ATGCTGACAAAATATGCCCTTGTGGCAATCATCGTACTGTGTTGTACAGTACTGGGATTCACGCTGATGGTAGGCGACTC
GTTGTGTGAGTTGAGTATCAGAGAACGTGGTATGGAGTTTAAGGCAGTTCTCGCTTACGAATCGAAGAAGTAG
Antitoxin
Download Length: 225 bp
>AT138398 NZ_CP043336:c91633-91409 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|