Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1475203..1475387 | Replicon | chromosome |
Accession | NZ_CP043302 | ||
Organism | Staphylococcus aureus strain 16445 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | FQP84_RS07520 | Protein ID | WP_000482650.1 |
Coordinates | 1475203..1475310 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1475327..1475387 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FQP84_RS07495 | 1470565..1471038 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
FQP84_RS07500 | 1471161..1472372 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
FQP84_RS07505 | 1472554..1473213 | - | 660 | WP_000831298.1 | membrane protein | - |
FQP84_RS07510 | 1473273..1474415 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
FQP84_RS07515 | 1474683..1475069 | + | 387 | WP_000779358.1 | flippase GtxA | - |
FQP84_RS07520 | 1475203..1475310 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1475327..1475387 | - | 61 | - | - | Antitoxin |
FQP84_RS07525 | 1475938..1477701 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
FQP84_RS07530 | 1477726..1479459 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
FQP84_RS07535 | 1479690..1479857 | + | 168 | WP_001789936.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T138305 WP_000482650.1 NZ_CP043302:1475203-1475310 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T138305 NZ_CP043302:1475203-1475310 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT138305 NZ_CP043302:c1475387-1475327 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|