Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 71179..71432 | Replicon | plasmid p2_025985 |
Accession | NZ_CP043289 | ||
Organism | Escherichia coli strain WCHEC025985 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | FYK42_RS25935 | Protein ID | WP_001312851.1 |
Coordinates | 71283..71432 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 71179..71238 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYK42_RS25900 (66955) | 66955..67815 | + | 861 | WP_000704523.1 | alpha/beta hydrolase | - |
FYK42_RS25905 (67918) | 67918..68478 | + | 561 | WP_000139321.1 | fertility inhibition protein FinO | - |
FYK42_RS25910 (68607) | 68607..68819 | + | 213 | WP_001309245.1 | ANR family transcriptional regulator | - |
FYK42_RS25915 (69064) | 69064..69525 | + | 462 | WP_001233838.1 | thermonuclease family protein | - |
FYK42_RS25920 (69571) | 69571..69780 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
FYK42_RS25925 (69818) | 69818..70408 | + | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
FYK42_RS25930 (70563) | 70563..71036 | + | 474 | WP_016240489.1 | hypothetical protein | - |
- (71179) | 71179..71238 | - | 60 | NuclAT_1 | - | Antitoxin |
- (71179) | 71179..71238 | - | 60 | NuclAT_1 | - | Antitoxin |
- (71179) | 71179..71238 | - | 60 | NuclAT_1 | - | Antitoxin |
- (71179) | 71179..71238 | - | 60 | NuclAT_1 | - | Antitoxin |
FYK42_RS25935 (71283) | 71283..71432 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
FYK42_RS25940 (71717) | 71717..71965 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
FYK42_RS25945 (72080) | 72080..72264 | + | 185 | Protein_92 | protein CopA/IncA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(B) | - | 1..72276 | 72276 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T138262 WP_001312851.1 NZ_CP043289:71283-71432 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T138262 NZ_CP057504:1911852-1911955 [Escherichia fergusonii]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 60 bp
>AT138262 NZ_CP043289:c71238-71179 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|