Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 64277..64531 Replicon plasmid pCTXM55_025985
Accession NZ_CP043286
Organism Escherichia coli strain WCHEC025985

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag FYK42_RS24390 Protein ID WP_001312851.1
Coordinates 64277..64426 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 64470..64531 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FYK42_RS24350 (59829) 59829..60230 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
FYK42_RS24355 (60163) 60163..60420 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
FYK42_RS24360 (60513) 60513..61166 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
FYK42_RS24365 (62105) 62105..62962 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
FYK42_RS24370 (62955) 62955..63437 - 483 WP_001273588.1 hypothetical protein -
FYK42_RS24375 (63430) 63430..63477 - 48 WP_229471593.1 hypothetical protein -
FYK42_RS24380 (63468) 63468..63719 + 252 WP_223195197.1 replication protein RepA -
FYK42_RS24385 (63736) 63736..63993 - 258 WP_000083845.1 replication regulatory protein RepA -
FYK42_RS24390 (64277) 64277..64426 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (64470) 64470..64531 + 62 NuclAT_1 - Antitoxin
- (64470) 64470..64531 + 62 NuclAT_1 - Antitoxin
- (64470) 64470..64531 + 62 NuclAT_1 - Antitoxin
- (64470) 64470..64531 + 62 NuclAT_1 - Antitoxin
FYK42_RS24395 (64787) 64787..64861 - 75 Protein_77 endonuclease -
FYK42_RS24400 (65107) 65107..65319 - 213 WP_001299730.1 ANR family transcriptional regulator -
FYK42_RS24405 (65455) 65455..66015 - 561 WP_000139315.1 fertility inhibition protein FinO -
FYK42_RS24410 (66118) 66118..66978 - 861 WP_000704513.1 alpha/beta hydrolase -
FYK42_RS24415 (67037) 67037..67783 - 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 / cmlA1 / ARR-3 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / ant(3'')-Ia / lnu(F) / sitABCD iutA / iucD / iucC / iucB / iucB / iucA 1..111058 111058


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T138250 WP_001312851.1 NZ_CP043286:c64426-64277 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T138250 NZ_CP057481:c4315974-4315822 [Escherichia fergusonii]
ATGCCGCAGAAATACGGATTACTTTCGTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGAGAATTATGAGCTGGCGGCGTTTTTAGCCTGCAAATTGAAAGAGTAA

Antitoxin


Download         Length: 62 bp

>AT138250 NZ_CP043286:64470-64531 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References