Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3661294..3661551 | Replicon | chromosome |
| Accession | NZ_CP043271 | ||
| Organism | Escherichia albertii strain RM9973 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | FYK17_RS17540 | Protein ID | WP_001135738.1 |
| Coordinates | 3661294..3661446 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 3661497..3661551 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYK17_RS17515 | 3657397..3658057 | + | 661 | Protein_3418 | OmpA family lipoprotein | - |
| FYK17_RS17520 | 3658161..3659135 | + | 975 | WP_207610283.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| FYK17_RS17525 | 3659188..3659898 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| FYK17_RS17530 | 3660321..3660611 | + | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
| FYK17_RS17535 | 3660894..3661106 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| FYK17_RS17540 | 3661294..3661446 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 3661497..3661551 | + | 55 | - | - | Antitoxin |
| FYK17_RS17545 | 3661769..3663838 | - | 2070 | WP_059217117.1 | glycine--tRNA ligase subunit beta | - |
| FYK17_RS17550 | 3663848..3664759 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| FYK17_RS17555 | 3664855..3665154 | - | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
| FYK17_RS17560 | 3665327..3666322 | + | 996 | WP_001182625.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T138147 WP_001135738.1 NZ_CP043271:c3661446-3661294 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T138147 NZ_CP043271:c3661446-3661294 [Escherichia albertii]
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATCTGAAAGAGTAA
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATCTGAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT138147 NZ_CP043271:3661497-3661551 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|