Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3885457..3885714 | Replicon | chromosome |
Accession | NZ_CP043266 | ||
Organism | Escherichia albertii strain RM9974 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | V0YDF1 |
Locus tag | FYK18_RS19545 | Protein ID | WP_001135738.1 |
Coordinates | 3885457..3885609 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 3885666..3885714 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYK18_RS19515 | 3881561..3882220 | + | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
FYK18_RS19520 | 3882324..3883298 | + | 975 | WP_059221283.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
FYK18_RS19525 | 3883351..3884061 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
FYK18_RS19530 | 3884484..3884774 | + | 291 | WP_059221281.1 | HTH-type transcriptional regulator | - |
FYK18_RS19535 | 3885057..3885269 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
FYK18_RS19540 | 3885409..3885480 | + | 72 | WP_212734940.1 | hypothetical protein | - |
FYK18_RS19545 | 3885457..3885609 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
- | 3885666..3885714 | + | 49 | - | - | Antitoxin |
FYK18_RS19550 | 3885997..3886455 | - | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
FYK18_RS19555 | 3886642..3888711 | - | 2070 | WP_059221279.1 | glycine--tRNA ligase subunit beta | - |
FYK18_RS19560 | 3888721..3889632 | - | 912 | WP_149534865.1 | glycine--tRNA ligase subunit alpha | - |
FYK18_RS19565 | 3889728..3890027 | - | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3885997..3886455 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T138120 WP_001135738.1 NZ_CP043266:c3885609-3885457 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T138120 NZ_CP043266:c3885609-3885457 [Escherichia albertii]
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGGGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATCTGAAAGAGTAA
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGGGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATCTGAAAGAGTAA
Antitoxin
Download Length: 49 bp
>AT138120 NZ_CP043266:3885666-3885714 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|