Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3993254..3993511 | Replicon | chromosome |
| Accession | NZ_CP043262 | ||
| Organism | Escherichia albertii strain RM9976 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | FYK19_RS19815 | Protein ID | WP_001135738.1 |
| Coordinates | 3993254..3993406 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 3993457..3993511 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYK19_RS19785 | 3989358..3990017 | + | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
| FYK19_RS19790 | 3990121..3991095 | + | 975 | WP_000804993.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| FYK19_RS19795 | 3991148..3991858 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| FYK19_RS19800 | 3992281..3992571 | + | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
| FYK19_RS19805 | 3992854..3993066 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| FYK19_RS19810 | 3993206..3993277 | + | 72 | WP_212734940.1 | hypothetical protein | - |
| FYK19_RS19815 | 3993254..3993406 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 3993457..3993511 | + | 55 | - | - | Antitoxin |
| FYK19_RS19820 | 3993729..3995798 | - | 2070 | WP_001291807.1 | glycine--tRNA ligase subunit beta | - |
| FYK19_RS19825 | 3995808..3996719 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| FYK19_RS19830 | 3996815..3997114 | - | 300 | WP_025238111.1 | YsaB family lipoprotein | - |
| FYK19_RS19835 | 3997287..3998282 | + | 996 | WP_161537844.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T138083 WP_001135738.1 NZ_CP043262:c3993406-3993254 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T138083 NZ_CP043262:c3993406-3993254 [Escherichia albertii]
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATCTGAAAGAGTAA
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATCTGAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT138083 NZ_CP043262:3993457-3993511 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|