Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2504318..2504543 | Replicon | chromosome |
| Accession | NZ_CP043262 | ||
| Organism | Escherichia albertii strain RM9976 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | FYK19_RS12280 | Protein ID | WP_000813254.1 |
| Coordinates | 2504318..2504473 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2504485..2504543 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYK19_RS12235 | 2499414..2500193 | - | 780 | WP_059214840.1 | ParB/Srx family N-terminal domain-containing protein | - |
| FYK19_RS12240 | 2500479..2500757 | - | 279 | WP_233991579.1 | hypothetical protein | - |
| FYK19_RS12245 | 2500642..2501034 | - | 393 | WP_059214839.1 | DUF2570 domain-containing protein | - |
| FYK19_RS12250 | 2501018..2501494 | - | 477 | WP_001194114.1 | glycoside hydrolase family protein | - |
| FYK19_RS12255 | 2501498..2501833 | - | 336 | WP_001766841.1 | phage holin, lambda family | - |
| FYK19_RS12260 | 2502331..2502873 | - | 543 | WP_059214837.1 | DUF1133 family protein | - |
| FYK19_RS12265 | 2502870..2503111 | - | 242 | Protein_2400 | DUF1364 domain-containing protein | - |
| FYK19_RS12270 | 2503159..2503758 | - | 600 | WP_059214836.1 | DUF1367 family protein | - |
| FYK19_RS12275 | 2503830..2504042 | - | 213 | WP_072248386.1 | hypothetical protein | - |
| FYK19_RS12280 | 2504318..2504473 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2504485..2504543 | + | 59 | - | - | Antitoxin |
| FYK19_RS12285 | 2505020..2505571 | - | 552 | WP_233991578.1 | DUF551 domain-containing protein | - |
| FYK19_RS12290 | 2505573..2506001 | - | 429 | WP_233991577.1 | hypothetical protein | - |
| FYK19_RS12295 | 2506132..2506434 | - | 303 | WP_233991594.1 | hypothetical protein | - |
| FYK19_RS12300 | 2506430..2506694 | - | 265 | Protein_2407 | hypothetical protein | - |
| FYK19_RS12305 | 2506691..2507107 | - | 417 | WP_059224269.1 | DUF977 family protein | - |
| FYK19_RS12310 | 2507115..2507876 | - | 762 | WP_233991576.1 | DUF1627 domain-containing protein | - |
| FYK19_RS12315 | 2507900..2508646 | - | 747 | WP_262939501.1 | ATP-binding protein | - |
| FYK19_RS12320 | 2508653..2509441 | - | 789 | WP_059224271.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T138077 WP_000813254.1 NZ_CP043262:c2504473-2504318 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T138077 NZ_CP043262:c2504473-2504318 [Escherichia albertii]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT138077 NZ_CP043262:2504485-2504543 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|