137660

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2302812..2303034 Replicon chromosome
Accession NZ_CP043199
Organism Escherichia coli O16:H48 strain PG20180060

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag FYA11_RS11180 Protein ID WP_000170963.1
Coordinates 2302812..2302919 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2302967..2303034 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FYA11_RS11145 2298121..2299203 + 1083 WP_148871287.1 peptide chain release factor 1 -
FYA11_RS11150 2299203..2300036 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
FYA11_RS11155 2300033..2300425 + 393 WP_000200374.1 invasion regulator SirB2 -
FYA11_RS11160 2300429..2301238 + 810 WP_001257044.1 invasion regulator SirB1 -
FYA11_RS11165 2301274..2302128 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FYA11_RS11170 2302277..2302384 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2302432..2302498 + 67 NuclAT_34 - -
- 2302432..2302498 + 67 NuclAT_34 - -
- 2302432..2302498 + 67 NuclAT_34 - -
- 2302432..2302498 + 67 NuclAT_34 - -
- 2302432..2302498 + 67 NuclAT_36 - -
- 2302432..2302498 + 67 NuclAT_36 - -
- 2302432..2302498 + 67 NuclAT_36 - -
- 2302432..2302498 + 67 NuclAT_36 - -
- 2302432..2302498 + 67 NuclAT_38 - -
- 2302432..2302498 + 67 NuclAT_38 - -
- 2302432..2302498 + 67 NuclAT_38 - -
- 2302432..2302498 + 67 NuclAT_38 - -
- 2302432..2302498 + 67 NuclAT_40 - -
- 2302432..2302498 + 67 NuclAT_40 - -
- 2302432..2302498 + 67 NuclAT_40 - -
- 2302432..2302498 + 67 NuclAT_40 - -
- 2302432..2302498 + 67 NuclAT_42 - -
- 2302432..2302498 + 67 NuclAT_42 - -
- 2302432..2302498 + 67 NuclAT_42 - -
- 2302432..2302498 + 67 NuclAT_42 - -
- 2302432..2302498 + 67 NuclAT_44 - -
- 2302432..2302498 + 67 NuclAT_44 - -
- 2302432..2302498 + 67 NuclAT_44 - -
- 2302432..2302498 + 67 NuclAT_44 - -
- 2302434..2302499 + 66 NuclAT_18 - -
- 2302434..2302499 + 66 NuclAT_18 - -
- 2302434..2302499 + 66 NuclAT_18 - -
- 2302434..2302499 + 66 NuclAT_18 - -
- 2302434..2302499 + 66 NuclAT_21 - -
- 2302434..2302499 + 66 NuclAT_21 - -
- 2302434..2302499 + 66 NuclAT_21 - -
- 2302434..2302499 + 66 NuclAT_21 - -
- 2302434..2302499 + 66 NuclAT_24 - -
- 2302434..2302499 + 66 NuclAT_24 - -
- 2302434..2302499 + 66 NuclAT_24 - -
- 2302434..2302499 + 66 NuclAT_24 - -
- 2302434..2302499 + 66 NuclAT_27 - -
- 2302434..2302499 + 66 NuclAT_27 - -
- 2302434..2302499 + 66 NuclAT_27 - -
- 2302434..2302499 + 66 NuclAT_27 - -
- 2302434..2302499 + 66 NuclAT_30 - -
- 2302434..2302499 + 66 NuclAT_30 - -
- 2302434..2302499 + 66 NuclAT_30 - -
- 2302434..2302499 + 66 NuclAT_30 - -
- 2302434..2302499 + 66 NuclAT_33 - -
- 2302434..2302499 + 66 NuclAT_33 - -
- 2302434..2302499 + 66 NuclAT_33 - -
- 2302434..2302499 + 66 NuclAT_33 - -
FYA11_RS11180 2302812..2302919 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2302967..2303034 + 68 NuclAT_17 - Antitoxin
- 2302967..2303034 + 68 NuclAT_17 - Antitoxin
- 2302967..2303034 + 68 NuclAT_17 - Antitoxin
- 2302967..2303034 + 68 NuclAT_17 - Antitoxin
- 2302967..2303034 + 68 NuclAT_20 - Antitoxin
- 2302967..2303034 + 68 NuclAT_20 - Antitoxin
- 2302967..2303034 + 68 NuclAT_20 - Antitoxin
- 2302967..2303034 + 68 NuclAT_20 - Antitoxin
- 2302967..2303034 + 68 NuclAT_23 - Antitoxin
- 2302967..2303034 + 68 NuclAT_23 - Antitoxin
- 2302967..2303034 + 68 NuclAT_23 - Antitoxin
- 2302967..2303034 + 68 NuclAT_23 - Antitoxin
- 2302967..2303034 + 68 NuclAT_26 - Antitoxin
- 2302967..2303034 + 68 NuclAT_26 - Antitoxin
- 2302967..2303034 + 68 NuclAT_26 - Antitoxin
- 2302967..2303034 + 68 NuclAT_26 - Antitoxin
- 2302967..2303034 + 68 NuclAT_29 - Antitoxin
- 2302967..2303034 + 68 NuclAT_29 - Antitoxin
- 2302967..2303034 + 68 NuclAT_29 - Antitoxin
- 2302967..2303034 + 68 NuclAT_29 - Antitoxin
- 2302967..2303034 + 68 NuclAT_32 - Antitoxin
- 2302967..2303034 + 68 NuclAT_32 - Antitoxin
- 2302967..2303034 + 68 NuclAT_32 - Antitoxin
- 2302967..2303034 + 68 NuclAT_32 - Antitoxin
- 2302968..2303033 + 66 NuclAT_35 - -
- 2302968..2303033 + 66 NuclAT_35 - -
- 2302968..2303033 + 66 NuclAT_35 - -
- 2302968..2303033 + 66 NuclAT_35 - -
- 2302968..2303033 + 66 NuclAT_37 - -
- 2302968..2303033 + 66 NuclAT_37 - -
- 2302968..2303033 + 66 NuclAT_37 - -
- 2302968..2303033 + 66 NuclAT_37 - -
- 2302968..2303033 + 66 NuclAT_39 - -
- 2302968..2303033 + 66 NuclAT_39 - -
- 2302968..2303033 + 66 NuclAT_39 - -
- 2302968..2303033 + 66 NuclAT_39 - -
- 2302968..2303033 + 66 NuclAT_41 - -
- 2302968..2303033 + 66 NuclAT_41 - -
- 2302968..2303033 + 66 NuclAT_41 - -
- 2302968..2303033 + 66 NuclAT_41 - -
- 2302968..2303033 + 66 NuclAT_43 - -
- 2302968..2303033 + 66 NuclAT_43 - -
- 2302968..2303033 + 66 NuclAT_43 - -
- 2302968..2303033 + 66 NuclAT_43 - -
- 2302968..2303033 + 66 NuclAT_45 - -
- 2302968..2303033 + 66 NuclAT_45 - -
- 2302968..2303033 + 66 NuclAT_45 - -
- 2302968..2303033 + 66 NuclAT_45 - -
FYA11_RS11190 2303347..2303454 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2303502..2303569 + 68 NuclAT_16 - -
- 2303502..2303569 + 68 NuclAT_16 - -
- 2303502..2303569 + 68 NuclAT_16 - -
- 2303502..2303569 + 68 NuclAT_16 - -
- 2303502..2303569 + 68 NuclAT_19 - -
- 2303502..2303569 + 68 NuclAT_19 - -
- 2303502..2303569 + 68 NuclAT_19 - -
- 2303502..2303569 + 68 NuclAT_19 - -
- 2303502..2303569 + 68 NuclAT_22 - -
- 2303502..2303569 + 68 NuclAT_22 - -
- 2303502..2303569 + 68 NuclAT_22 - -
- 2303502..2303569 + 68 NuclAT_22 - -
- 2303502..2303569 + 68 NuclAT_25 - -
- 2303502..2303569 + 68 NuclAT_25 - -
- 2303502..2303569 + 68 NuclAT_25 - -
- 2303502..2303569 + 68 NuclAT_25 - -
- 2303502..2303569 + 68 NuclAT_28 - -
- 2303502..2303569 + 68 NuclAT_28 - -
- 2303502..2303569 + 68 NuclAT_28 - -
- 2303502..2303569 + 68 NuclAT_28 - -
- 2303502..2303569 + 68 NuclAT_31 - -
- 2303502..2303569 + 68 NuclAT_31 - -
- 2303502..2303569 + 68 NuclAT_31 - -
- 2303502..2303569 + 68 NuclAT_31 - -
FYA11_RS11200 2303858..2304958 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
FYA11_RS11205 2305228..2305458 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FYA11_RS11210 2305616..2306311 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
FYA11_RS11215 2306355..2306708 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T137660 WP_000170963.1 NZ_CP043199:c2302919-2302812 [Escherichia coli O16:H48]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T137660 NZ_CP043199:c2302919-2302812 [Escherichia coli O16:H48]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT137660 NZ_CP043199:2302967-2303034 [Escherichia coli O16:H48]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References