Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3389725..3389983 | Replicon | chromosome |
Accession | NZ_CP043185 | ||
Organism | Escherichia coli O16:H48 strain PG20180171 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | FYA18_RS16340 | Protein ID | WP_000809168.1 |
Coordinates | 3389725..3389877 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3389926..3389983 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FYA18_RS16325 | 3385137..3387053 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
FYA18_RS16330 | 3387142..3388272 | + | 1131 | WP_001118476.1 | molecular chaperone DnaJ | - |
FYA18_RS16335 | 3388419..3389531 | + | 1113 | WP_001300563.1 | IS4-like element IS421 family transposase | - |
FYA18_RS16340 | 3389725..3389877 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 3389926..3389983 | + | 58 | - | - | Antitoxin |
FYA18_RS16345 | 3390463..3391629 | + | 1167 | WP_000681354.1 | Na+/H+ antiporter NhaA | - |
FYA18_RS16350 | 3391695..3392594 | + | 900 | WP_001338226.1 | transcriptional activator NhaR | - |
FYA18_RS22670 | 3392632..3392769 | - | 138 | Protein_3175 | fimbrial family protein | - |
FYA18_RS16355 | 3392785..3393482 | - | 698 | Protein_3176 | IS1-like element IS1A family transposase | - |
FYA18_RS16360 | 3393789..3394052 | - | 264 | WP_001274021.1 | 30S ribosomal protein S20 | - |
FYA18_RS16365 | 3394155..3394373 | + | 219 | WP_001300728.1 | DUF2575 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 3388419..3393482 | 5063 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T137453 WP_000809168.1 NZ_CP043185:c3389877-3389725 [Escherichia coli O16:H48]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T137453 NZ_CP043185:c3389877-3389725 [Escherichia coli O16:H48]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT137453 NZ_CP043185:3389926-3389983 [Escherichia coli O16:H48]
GTTCAGCATATAGGAGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGAGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|