Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4621995..4622220 | Replicon | chromosome |
| Accession | NZ_CP043181 | ||
| Organism | Escherichia coli O2:H6 strain PG20180057 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | FYA20_RS22420 | Protein ID | WP_000813254.1 |
| Coordinates | 4622065..4622220 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4621995..4622053 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FYA20_RS22395 | 4618077..4618508 | + | 432 | WP_148886038.1 | DUF977 family protein | - |
| FYA20_RS22400 | 4618832..4619071 | + | 240 | WP_148886040.1 | hypothetical protein | - |
| FYA20_RS22405 | 4619074..4619670 | + | 597 | WP_148886041.1 | hypothetical protein | - |
| FYA20_RS22410 | 4619894..4621618 | + | 1725 | WP_148886043.1 | DUF2326 domain-containing protein | - |
| - | 4621995..4622053 | - | 59 | - | - | Antitoxin |
| FYA20_RS22420 | 4622065..4622220 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| FYA20_RS22425 | 4622387..4622659 | + | 273 | WP_001341173.1 | hypothetical protein | - |
| FYA20_RS22430 | 4622661..4623710 | + | 1050 | WP_148886047.1 | DUF968 domain-containing protein | - |
| FYA20_RS22435 | 4623723..4624097 | + | 375 | WP_148886048.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FYA20_RS22440 | 4624094..4624915 | + | 822 | WP_034173000.1 | antitermination protein | - |
| FYA20_RS22445 | 4625142..4625339 | + | 198 | WP_000917768.1 | hypothetical protein | - |
| FYA20_RS22450 | 4625489..4626547 | + | 1059 | WP_148886050.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4610051..4622659 | 12608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T137385 WP_000813254.1 NZ_CP043181:4622065-4622220 [Escherichia coli O2:H6]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T137385 NZ_CP043181:4622065-4622220 [Escherichia coli O2:H6]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT137385 NZ_CP043181:c4622053-4621995 [Escherichia coli O2:H6]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|