Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2034385..2034610 | Replicon | chromosome |
| Accession | NZ_CP042980 | ||
| Organism | Shigella flexneri Y strain PE577 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | FW259_RS10770 | Protein ID | WP_000935258.1 |
| Coordinates | 2034385..2034597 (-) | Length | 71 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2034552..2034610 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FW259_RS10705 | 2029697..2030047 | - | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| FW259_RS10710 | 2030044..2030718 | - | 675 | WP_004967157.1 | IS66 family insertion sequence hypothetical protein | - |
| FW259_RS10715 | 2030817..2031032 | - | 216 | WP_000839572.1 | class II holin family protein | - |
| FW259_RS10745 | 2031833..2032516 | - | 684 | WP_005049343.1 | antiterminator | - |
| FW259_RS10750 | 2032513..2032878 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FW259_RS10755 | 2032879..2033937 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| FW259_RS10760 | 2033939..2034217 | - | 279 | WP_011069426.1 | hypothetical protein | - |
| FW259_RS10770 | 2034385..2034597 | - | 213 | WP_000935258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 2034552..2034610 | + | 59 | - | - | Antitoxin |
| FW259_RS10785 | 2035192..2035608 | - | 417 | WP_005069274.1 | hypothetical protein | - |
| FW259_RS10790 | 2035635..2035775 | + | 141 | Protein_2052 | DUF4224 domain-containing protein | - |
| FW259_RS10795 | 2035775..2036812 | + | 1038 | WP_004974968.1 | tyrosine-type recombinase/integrase | - |
| FW259_RS10805 | 2037023..2037820 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
| FW259_RS10815 | 2038158..2039420 | + | 1263 | Protein_2055 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 2002535..2071698 | 69163 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7856.42 Da Isoelectric Point: 8.7469
>T136845 WP_000935258.1 NZ_CP042980:c2034597-2034385 [Shigella flexneri Y]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 213 bp
>T136845 NZ_CP042980:c2034597-2034385 [Shigella flexneri Y]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTACGAATCC
GAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTACGAATCC
GAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT136845 NZ_CP042980:2034552-2034610 [Shigella flexneri Y]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|