Detailed information of TA system TA136775

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 25182..25451
• Replicon: plasmid pCFSAN061769_03
• Accession: NZ_CP042972
• Organism: Escherichia coli strain CFSAN061769

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: CA697_RS24575
• Protein ID: WP_001372321.1
• Coordinates: 25326..25451 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	25182..25247 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CA697_RS24555	20403..22361	+	1959	WP_000117179.1	ParB/RepB/Spo0J family partition protein	-
CA697_RS24560	22416..22850	+	435	WP_000845940.1	conjugation system SOS inhibitor PsiB	-
CA697_RS24565	22847..23609	+	763	Protein_29	plasmid SOS inhibition protein A	-
-	23578..23680	+	103	NuclAT_1	-	-
-	23578..23680	+	103	NuclAT_1	-	-
-	23578..23680	+	103	NuclAT_1	-	-
-	23578..23680	+	103	NuclAT_1	-	-
CA697_RS24570	23726..25095	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
-	25122..25249	+	128	NuclAT_0	-	-
-	25122..25249	+	128	NuclAT_0	-	-
-	25122..25249	+	128	NuclAT_0	-	-
-	25122..25249	+	128	NuclAT_0	-	-
-	25182..25247	+	66	-	-	Antitoxin
CA697_RS25435	25235..25384	+	150	Protein_31	plasmid maintenance protein Mok	-
CA697_RS24575	25326..25451	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
CA697_RS25440	25671..25901	+	231	WP_001426396.1	hypothetical protein	-
CA697_RS25445	25899..26072	-	174	Protein_34	hypothetical protein	-
CA697_RS24580	26142..26348	+	207	WP_000275859.1	hypothetical protein	-
CA697_RS24585	26373..26660	+	288	WP_000107535.1	hypothetical protein	-
CA697_RS24590	26779..27600	+	822	WP_001234469.1	DUF932 domain-containing protein	-
CA697_RS24595	27897..28499	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
CA697_RS24600	28830..29213	+	384	WP_001151566.1	conjugal transfer relaxosome DNA-binding protein TraM	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / sitABCD	iucA / iucB / iucC / iucD / iutA	1..129967	129967
	-	inside	IScluster/Tn	-	-	23726..30684	6958

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T136775 WP_001372321.1 NZ_CP042972:25326-25451 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T136775 NZ_CP042972:25326-25451 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT136775 NZ_CP042972:25182-25247 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin