Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2407151..2407408 | Replicon | chromosome |
| Accession | NZ_CP042945 | ||
| Organism | Escherichia fergusonii strain ATCC 35471 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | F4T5C6 |
| Locus tag | FV159_RS12680 | Protein ID | WP_001135731.1 |
| Coordinates | 2407256..2407408 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 2407151..2407199 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FV159_RS12660 | 2402382..2403377 | - | 996 | WP_002432855.1 | acyltransferase | - |
| FV159_RS12665 | 2403549..2403848 | + | 300 | WP_024256552.1 | YsaB family lipoprotein | - |
| FV159_RS12670 | 2403944..2404855 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| FV159_RS12675 | 2404865..2406934 | + | 2070 | WP_001291786.1 | glycine--tRNA ligase subunit beta | - |
| - | 2407151..2407199 | - | 49 | - | - | Antitoxin |
| FV159_RS12680 | 2407256..2407408 | + | 153 | WP_001135731.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| FV159_RS12685 | 2407566..2407937 | + | 372 | WP_001037803.1 | membrane protein insertion efficiency factor YidD | - |
| FV159_RS12690 | 2407991..2408203 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| FV159_RS12695 | 2408485..2408775 | - | 291 | WP_000455800.1 | HTH-type transcriptional regulator | - |
| FV159_RS12700 | 2409025..2410395 | - | 1371 | WP_000184983.1 | MFS transporter | - |
| FV159_RS12705 | 2410833..2411543 | + | 711 | WP_000190514.1 | DUF3053 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 6025.30 Da Isoelectric Point: 7.7169
>T136704 WP_001135731.1 NZ_CP042945:2407256-2407408 [Escherichia fergusonii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
Download Length: 153 bp
>T136704 NZ_CP042945:2407256-2407408 [Escherichia fergusonii]
ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGAGAATTATGAGCTGGCGGCGTTTTTAGCCTGCAAATTGAAAGAGTAA
ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGAGAATTATGAGCTGGCGGCGTTTTTAGCCTGCAAATTGAAAGAGTAA
Antitoxin
Download Length: 49 bp
>AT136704 NZ_CP042945:c2407199-2407151 [Escherichia fergusonii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|