Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 44792..45056 | Replicon | plasmid pNMBU-W12E19_02 |
| Accession | NZ_CP042886 | ||
| Organism | Escherichia coli O10:H32 strain NMBU-W12E19 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | FVP48_RS01260 | Protein ID | WP_001387489.1 |
| Coordinates | 44904..45056 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 44792..44854 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FVP48_RS01245 | 40894..41964 | - | 1071 | WP_000151588.1 | IncI1-type conjugal transfer protein TrbB | - |
| FVP48_RS01250 | 41983..43191 | - | 1209 | WP_000121263.1 | IncI1-type conjugal transfer protein TrbA | - |
| FVP48_RS01255 | 43498..44589 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
| - | 44792..44854 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 44792..44854 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 44792..44854 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 44792..44854 | - | 63 | NuclAT_0 | - | Antitoxin |
| FVP48_RS01260 | 44904..45056 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| FVP48_RS01265 | 45128..45379 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| FVP48_RS01270 | 45679..45975 | + | 297 | WP_001275298.1 | hypothetical protein | - |
| FVP48_RS01275 | 46040..46216 | - | 177 | WP_001054898.1 | hypothetical protein | - |
| FVP48_RS01280 | 46399..46608 | - | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
| FVP48_RS01285 | 46706..47320 | - | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| FVP48_RS01290 | 47396..49564 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrS1 / blaCTX-M-15 | - | 1..88772 | 88772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T136425 WP_001387489.1 NZ_CP042886:44904-45056 [Escherichia coli O10:H32]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T136425 NZ_CP042886:44904-45056 [Escherichia coli O10:H32]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT136425 NZ_CP042886:c44854-44792 [Escherichia coli O10:H32]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|