Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 51770..52040 | Replicon | plasmid pNMBU-W12E19_01 |
| Accession | NZ_CP042885 | ||
| Organism | Escherichia coli O10:H32 strain NMBU-W12E19 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | B1VC78 |
| Locus tag | FVP48_RS00305 | Protein ID | WP_001302184.1 |
| Coordinates | 51882..52040 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 51770..51833 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FVP48_RS00275 | 46857..47534 | + | 678 | WP_001401776.1 | IS66 family insertion sequence hypothetical protein | - |
| FVP48_RS00280 | 47531..47878 | + | 348 | WP_000631709.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| FVP48_RS00285 | 47898..49499 | + | 1602 | WP_032180886.1 | IS66 family transposase | - |
| FVP48_RS00290 | 49530..49796 | + | 267 | Protein_57 | IS66 family insertion sequence element accessory protein TnpB | - |
| FVP48_RS00295 | 49816..51386 | + | 1571 | Protein_58 | IS66 family transposase | - |
| FVP48_RS00300 | 51426..51701 | + | 276 | WP_001707307.1 | hypothetical protein | - |
| - | 51677..51838 | + | 162 | NuclAT_0 | - | - |
| - | 51677..51838 | + | 162 | NuclAT_0 | - | - |
| - | 51677..51838 | + | 162 | NuclAT_0 | - | - |
| - | 51677..51838 | + | 162 | NuclAT_0 | - | - |
| - | 51770..51833 | - | 64 | - | - | Antitoxin |
| FVP48_RS00305 | 51882..52040 | + | 159 | WP_001302184.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| FVP48_RS00310 | 52518..52712 | + | 195 | WP_173002228.1 | hypothetical protein | - |
| FVP48_RS00315 | 52939..53226 | + | 288 | WP_173002171.1 | hypothetical protein | - |
| FVP48_RS00320 | 53345..54166 | + | 822 | WP_173002229.1 | DUF945 domain-containing protein | - |
| FVP48_RS00325 | 54463..55020 | - | 558 | Protein_64 | transglycosylase SLT domain-containing protein | - |
| FVP48_RS00330 | 55396..55779 | + | 384 | WP_173002172.1 | relaxosome protein TraM | - |
| FVP48_RS00335 | 55973..56664 | + | 692 | Protein_66 | PAS domain-containing protein | - |
| FVP48_RS00340 | 56752..56979 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | aap/aspU | 1..167966 | 167966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6108.35 Da Isoelectric Point: 9.1977
>T136419 WP_001302184.1 NZ_CP042885:51882-52040 [Escherichia coli O10:H32]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 159 bp
>T136419 NZ_CP042885:51882-52040 [Escherichia coli O10:H32]
ATGAAACTACCACGCAGCTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGCAGCTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT136419 NZ_CP042885:c51833-51770 [Escherichia coli O10:H32]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|