Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1970397..1970619 | Replicon | chromosome |
Accession | NZ_CP042846 | ||
Organism | Escherichia coli strain JME64 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | J7R083 |
Locus tag | FVE20_RS09555 | Protein ID | WP_000170963.1 |
Coordinates | 1970397..1970504 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1970552..1970619 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FVE20_RS09520 | 1965706..1966788 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
FVE20_RS09525 | 1966788..1967621 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
FVE20_RS09530 | 1967618..1968010 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
FVE20_RS09535 | 1968014..1968823 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
FVE20_RS09540 | 1968859..1969713 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
FVE20_RS09545 | 1969862..1969969 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
- | 1970017..1970083 | + | 67 | NuclAT_34 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_34 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_34 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_34 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_36 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_36 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_36 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_36 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_38 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_38 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_38 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_38 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_40 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_40 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_40 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_40 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_42 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_42 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_42 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_42 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_44 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_44 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_44 | - | - |
- | 1970017..1970083 | + | 67 | NuclAT_44 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_18 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_18 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_18 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_18 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_21 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_21 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_21 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_21 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_24 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_24 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_24 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_24 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_27 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_27 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_27 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_27 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_30 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_30 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_30 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_30 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_33 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_33 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_33 | - | - |
- | 1970019..1970084 | + | 66 | NuclAT_33 | - | - |
FVE20_RS09555 | 1970397..1970504 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
- | 1970552..1970619 | + | 68 | NuclAT_17 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_17 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_17 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_17 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_20 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_20 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_20 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_20 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_23 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_23 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_23 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_23 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_26 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_26 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_26 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_26 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_29 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_29 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_29 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_29 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_32 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_32 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_32 | - | Antitoxin |
- | 1970552..1970619 | + | 68 | NuclAT_32 | - | Antitoxin |
- | 1970553..1970618 | + | 66 | NuclAT_35 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_35 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_35 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_35 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_37 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_37 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_37 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_37 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_39 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_39 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_39 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_39 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_41 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_41 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_41 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_41 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_43 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_43 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_43 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_43 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_45 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_45 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_45 | - | - |
- | 1970553..1970618 | + | 66 | NuclAT_45 | - | - |
FVE20_RS09565 | 1970932..1971039 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
- | 1971087..1971154 | + | 68 | NuclAT_16 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_16 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_16 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_16 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_19 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_19 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_19 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_19 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_22 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_22 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_22 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_22 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_25 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_25 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_25 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_25 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_28 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_28 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_28 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_28 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_31 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_31 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_31 | - | - |
- | 1971087..1971154 | + | 68 | NuclAT_31 | - | - |
FVE20_RS09575 | 1971443..1972543 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
FVE20_RS09580 | 1972813..1973043 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
FVE20_RS09585 | 1973201..1973896 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
FVE20_RS09590 | 1973940..1974293 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T136208 WP_000170963.1 NZ_CP042846:c1970504-1970397 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T136208 NZ_CP042846:c1970504-1970397 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT136208 NZ_CP042846:1970552-1970619 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|