136082

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1980926..1981148 Replicon chromosome
Accession NZ_CP042843
Organism Escherichia coli strain JME67

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag FVE23_RS09620 Protein ID WP_000170955.1
Coordinates 1980926..1981033 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1981081..1981148 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FVE23_RS09580 1976782..1977615 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
FVE23_RS09585 1977612..1978004 + 393 WP_000200374.1 invasion regulator SirB2 -
FVE23_RS09590 1978008..1978817 + 810 WP_001257044.1 invasion regulator SirB1 -
FVE23_RS09595 1978853..1979707 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FVE23_RS09600 1979856..1979963 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1980011..1980077 + 67 NuclAT_34 - -
- 1980011..1980077 + 67 NuclAT_34 - -
- 1980011..1980077 + 67 NuclAT_34 - -
- 1980011..1980077 + 67 NuclAT_34 - -
- 1980011..1980077 + 67 NuclAT_36 - -
- 1980011..1980077 + 67 NuclAT_36 - -
- 1980011..1980077 + 67 NuclAT_36 - -
- 1980011..1980077 + 67 NuclAT_36 - -
- 1980011..1980077 + 67 NuclAT_38 - -
- 1980011..1980077 + 67 NuclAT_38 - -
- 1980011..1980077 + 67 NuclAT_38 - -
- 1980011..1980077 + 67 NuclAT_38 - -
- 1980011..1980077 + 67 NuclAT_40 - -
- 1980011..1980077 + 67 NuclAT_40 - -
- 1980011..1980077 + 67 NuclAT_40 - -
- 1980011..1980077 + 67 NuclAT_40 - -
- 1980011..1980077 + 67 NuclAT_42 - -
- 1980011..1980077 + 67 NuclAT_42 - -
- 1980011..1980077 + 67 NuclAT_42 - -
- 1980011..1980077 + 67 NuclAT_42 - -
- 1980011..1980077 + 67 NuclAT_44 - -
- 1980011..1980077 + 67 NuclAT_44 - -
- 1980011..1980077 + 67 NuclAT_44 - -
- 1980011..1980077 + 67 NuclAT_44 - -
- 1980013..1980078 + 66 NuclAT_18 - -
- 1980013..1980078 + 66 NuclAT_18 - -
- 1980013..1980078 + 66 NuclAT_18 - -
- 1980013..1980078 + 66 NuclAT_18 - -
- 1980013..1980078 + 66 NuclAT_21 - -
- 1980013..1980078 + 66 NuclAT_21 - -
- 1980013..1980078 + 66 NuclAT_21 - -
- 1980013..1980078 + 66 NuclAT_21 - -
- 1980013..1980078 + 66 NuclAT_24 - -
- 1980013..1980078 + 66 NuclAT_24 - -
- 1980013..1980078 + 66 NuclAT_24 - -
- 1980013..1980078 + 66 NuclAT_24 - -
- 1980013..1980078 + 66 NuclAT_27 - -
- 1980013..1980078 + 66 NuclAT_27 - -
- 1980013..1980078 + 66 NuclAT_27 - -
- 1980013..1980078 + 66 NuclAT_27 - -
- 1980013..1980078 + 66 NuclAT_30 - -
- 1980013..1980078 + 66 NuclAT_30 - -
- 1980013..1980078 + 66 NuclAT_30 - -
- 1980013..1980078 + 66 NuclAT_30 - -
- 1980013..1980078 + 66 NuclAT_33 - -
- 1980013..1980078 + 66 NuclAT_33 - -
- 1980013..1980078 + 66 NuclAT_33 - -
- 1980013..1980078 + 66 NuclAT_33 - -
FVE23_RS09610 1980391..1980498 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1980546..1980613 + 68 NuclAT_17 - -
- 1980546..1980613 + 68 NuclAT_17 - -
- 1980546..1980613 + 68 NuclAT_17 - -
- 1980546..1980613 + 68 NuclAT_17 - -
- 1980546..1980613 + 68 NuclAT_20 - -
- 1980546..1980613 + 68 NuclAT_20 - -
- 1980546..1980613 + 68 NuclAT_20 - -
- 1980546..1980613 + 68 NuclAT_20 - -
- 1980546..1980613 + 68 NuclAT_23 - -
- 1980546..1980613 + 68 NuclAT_23 - -
- 1980546..1980613 + 68 NuclAT_23 - -
- 1980546..1980613 + 68 NuclAT_23 - -
- 1980546..1980613 + 68 NuclAT_26 - -
- 1980546..1980613 + 68 NuclAT_26 - -
- 1980546..1980613 + 68 NuclAT_26 - -
- 1980546..1980613 + 68 NuclAT_26 - -
- 1980546..1980613 + 68 NuclAT_29 - -
- 1980546..1980613 + 68 NuclAT_29 - -
- 1980546..1980613 + 68 NuclAT_29 - -
- 1980546..1980613 + 68 NuclAT_29 - -
- 1980546..1980613 + 68 NuclAT_32 - -
- 1980546..1980613 + 68 NuclAT_32 - -
- 1980546..1980613 + 68 NuclAT_32 - -
- 1980546..1980613 + 68 NuclAT_32 - -
- 1980547..1980612 + 66 NuclAT_35 - -
- 1980547..1980612 + 66 NuclAT_35 - -
- 1980547..1980612 + 66 NuclAT_35 - -
- 1980547..1980612 + 66 NuclAT_35 - -
- 1980547..1980612 + 66 NuclAT_37 - -
- 1980547..1980612 + 66 NuclAT_37 - -
- 1980547..1980612 + 66 NuclAT_37 - -
- 1980547..1980612 + 66 NuclAT_37 - -
- 1980547..1980612 + 66 NuclAT_39 - -
- 1980547..1980612 + 66 NuclAT_39 - -
- 1980547..1980612 + 66 NuclAT_39 - -
- 1980547..1980612 + 66 NuclAT_39 - -
- 1980547..1980612 + 66 NuclAT_41 - -
- 1980547..1980612 + 66 NuclAT_41 - -
- 1980547..1980612 + 66 NuclAT_41 - -
- 1980547..1980612 + 66 NuclAT_41 - -
- 1980547..1980612 + 66 NuclAT_43 - -
- 1980547..1980612 + 66 NuclAT_43 - -
- 1980547..1980612 + 66 NuclAT_43 - -
- 1980547..1980612 + 66 NuclAT_43 - -
- 1980547..1980612 + 66 NuclAT_45 - -
- 1980547..1980612 + 66 NuclAT_45 - -
- 1980547..1980612 + 66 NuclAT_45 - -
- 1980547..1980612 + 66 NuclAT_45 - -
FVE23_RS09620 1980926..1981033 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1981081..1981148 + 68 NuclAT_16 - Antitoxin
- 1981081..1981148 + 68 NuclAT_16 - Antitoxin
- 1981081..1981148 + 68 NuclAT_16 - Antitoxin
- 1981081..1981148 + 68 NuclAT_16 - Antitoxin
- 1981081..1981148 + 68 NuclAT_19 - Antitoxin
- 1981081..1981148 + 68 NuclAT_19 - Antitoxin
- 1981081..1981148 + 68 NuclAT_19 - Antitoxin
- 1981081..1981148 + 68 NuclAT_19 - Antitoxin
- 1981081..1981148 + 68 NuclAT_22 - Antitoxin
- 1981081..1981148 + 68 NuclAT_22 - Antitoxin
- 1981081..1981148 + 68 NuclAT_22 - Antitoxin
- 1981081..1981148 + 68 NuclAT_22 - Antitoxin
- 1981081..1981148 + 68 NuclAT_25 - Antitoxin
- 1981081..1981148 + 68 NuclAT_25 - Antitoxin
- 1981081..1981148 + 68 NuclAT_25 - Antitoxin
- 1981081..1981148 + 68 NuclAT_25 - Antitoxin
- 1981081..1981148 + 68 NuclAT_28 - Antitoxin
- 1981081..1981148 + 68 NuclAT_28 - Antitoxin
- 1981081..1981148 + 68 NuclAT_28 - Antitoxin
- 1981081..1981148 + 68 NuclAT_28 - Antitoxin
- 1981081..1981148 + 68 NuclAT_31 - Antitoxin
- 1981081..1981148 + 68 NuclAT_31 - Antitoxin
- 1981081..1981148 + 68 NuclAT_31 - Antitoxin
- 1981081..1981148 + 68 NuclAT_31 - Antitoxin
FVE23_RS09630 1981437..1982537 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
FVE23_RS09635 1982807..1983037 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FVE23_RS09640 1983195..1983890 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
FVE23_RS09645 1983934..1984287 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
FVE23_RS09650 1984472..1985866 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T136082 WP_000170955.1 NZ_CP042843:c1981033-1980926 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T136082 NZ_CP042843:c1981033-1980926 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT136082 NZ_CP042843:1981081-1981148 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References