Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2565335..2565519 | Replicon | chromosome |
| Accession | NZ_CP042650 | ||
| Organism | Staphylococcus aureus strain X22 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | FTD94_RS13205 | Protein ID | WP_000482647.1 |
| Coordinates | 2565412..2565519 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2565335..2565395 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FTD94_RS13190 | 2560865..2561032 | - | 168 | WP_001790576.1 | hypothetical protein | - |
| FTD94_RS13195 | 2561263..2562996 | - | 1734 | WP_044291035.1 | ABC transporter ATP-binding protein/permease | - |
| FTD94_RS13200 | 2563021..2564784 | - | 1764 | WP_044291037.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2565335..2565395 | + | 61 | - | - | Antitoxin |
| FTD94_RS13205 | 2565412..2565519 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| FTD94_RS13210 | 2565653..2566039 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| FTD94_RS13215 | 2566297..2567439 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| FTD94_RS13220 | 2567499..2568158 | + | 660 | WP_000831298.1 | membrane protein | - |
| FTD94_RS13225 | 2568340..2569551 | + | 1212 | WP_147091819.1 | multidrug effflux MFS transporter | - |
| FTD94_RS13230 | 2569692..2570147 | - | 456 | WP_044291042.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sbi / hlgA / hlgA / hlgC / hlgB | 2550165..2568158 | 17993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T136020 WP_000482647.1 NZ_CP042650:c2565519-2565412 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T136020 NZ_CP042650:c2565519-2565412 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT136020 NZ_CP042650:2565335-2565395 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|