Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2284507..2284723 | Replicon | chromosome |
Accession | NZ_CP042650 | ||
Organism | Staphylococcus aureus strain X22 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | FTD94_RS11720 | Protein ID | WP_001802298.1 |
Coordinates | 2284619..2284723 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2284507..2284562 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FTD94_RS11700 | 2280770..2281435 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
FTD94_RS11705 | 2281587..2281907 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
FTD94_RS11710 | 2281909..2282886 | + | 978 | WP_006190804.1 | CDF family zinc efflux transporter CzrB | - |
FTD94_RS11715 | 2283152..2284243 | + | 1092 | WP_044290727.1 | lytic regulatory protein | - |
- | 2284507..2284562 | + | 56 | - | - | Antitoxin |
FTD94_RS11720 | 2284619..2284723 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
FTD94_RS14955 | 2285240..2285410 | + | 171 | WP_001792292.1 | transposase | - |
FTD94_RS11730 | 2285403..2285561 | + | 159 | WP_001792784.1 | hypothetical protein | - |
FTD94_RS11740 | 2286220..2287077 | - | 858 | WP_044290728.1 | Cof-type HAD-IIB family hydrolase | - |
FTD94_RS11745 | 2287145..2287927 | - | 783 | WP_044290729.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T136018 WP_001802298.1 NZ_CP042650:c2284723-2284619 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T136018 NZ_CP042650:c2284723-2284619 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT136018 NZ_CP042650:2284507-2284562 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|