Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 26078..26348 | Replicon | plasmid unnamed |
Accession | NZ_CP042362 | ||
Organism | Lelliottia amnigena strain A167 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | FS593_RS21725 | Protein ID | WP_223176086.1 |
Coordinates | 26232..26348 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 26078..26137 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FS593_RS21695 | 21861..22433 | + | 573 | WP_235135836.1 | hypothetical protein | - |
FS593_RS21700 | 22503..24515 | + | 2013 | WP_235135837.1 | ParB/RepB/Spo0J family partition protein | - |
FS593_RS21705 | 24552..24986 | + | 435 | WP_235135838.1 | conjugation system SOS inhibitor PsiB | - |
FS593_RS21710 | 24983..25714 | + | 732 | WP_235135839.1 | plasmid SOS inhibition protein A | - |
FS593_RS21715 | 25711..25941 | + | 231 | WP_235135840.1 | hypothetical protein | - |
- | 26016..26137 | + | 122 | NuclAT_0 | - | - |
- | 26016..26137 | + | 122 | NuclAT_0 | - | - |
- | 26016..26137 | + | 122 | NuclAT_0 | - | - |
- | 26016..26137 | + | 122 | NuclAT_0 | - | - |
- | 26078..26137 | + | 60 | - | - | Antitoxin |
FS593_RS21720 | 26132..26281 | + | 150 | Protein_28 | DUF5431 family protein | - |
FS593_RS21725 | 26232..26348 | + | 117 | WP_223176086.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FS593_RS21730 | 27324..27638 | + | 315 | WP_235135841.1 | hypothetical protein | - |
FS593_RS21735 | 27644..28465 | + | 822 | WP_235135842.1 | DUF932 domain-containing protein | - |
FS593_RS21740 | 28493..29032 | - | 540 | WP_235135843.1 | lytic transglycosylase domain-containing protein | - |
FS593_RS21745 | 29687..30073 | + | 387 | WP_235135844.1 | relaxosome protein TraM | - |
FS593_RS21750 | 30113..30754 | - | 642 | WP_235135845.1 | Arc family DNA-binding protein | - |
FS593_RS21755 | 30951..31304 | + | 354 | WP_235135846.1 | type IV conjugative transfer system pilin TraA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..141490 | 141490 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4490.28 Da Isoelectric Point: 8.5046
>T135605 WP_223176086.1 NZ_CP042362:26232-26348 [Lelliottia amnigena]
VCLTLLIFTYLTRKSLCEIRYRDTNREVAAFMAYESAK
VCLTLLIFTYLTRKSLCEIRYRDTNREVAAFMAYESAK
Download Length: 117 bp
>T135605 NZ_CP042362:26232-26348 [Lelliottia amnigena]
GTGTGTCTCACACTGCTGATATTCACTTACCTGACGCGCAAATCGCTCTGCGAAATTCGTTACAGGGACACGAACAGGGA
GGTGGCCGCTTTTATGGCTTACGAATCCGCTAAGTAG
GTGTGTCTCACACTGCTGATATTCACTTACCTGACGCGCAAATCGCTCTGCGAAATTCGTTACAGGGACACGAACAGGGA
GGTGGCCGCTTTTATGGCTTACGAATCCGCTAAGTAG
Antitoxin
Download Length: 60 bp
>AT135605 NZ_CP042362:26078-26137 [Lelliottia amnigena]
AGCAGAAAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCCACCTGTATGTCT
AGCAGAAAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCCACCTGTATGTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|