Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2050283..2050582 | Replicon | chromosome |
Accession | NZ_CP042348 | ||
Organism | Staphylococcus aureus strain BSN9R |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | FSN22_RS10355 | Protein ID | WP_011447039.1 |
Coordinates | 2050406..2050582 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2050283..2050338 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FSN22_RS10310 | 2045614..2045874 | + | 261 | WP_001791826.1 | hypothetical protein | - |
FSN22_RS10315 | 2045927..2046277 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
FSN22_RS10320 | 2046962..2047411 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
FSN22_RS10325 | 2047506..2047841 | - | 336 | Protein_1940 | SH3 domain-containing protein | - |
FSN22_RS10335 | 2048491..2048982 | - | 492 | WP_000919350.1 | staphylokinase | - |
FSN22_RS10340 | 2049173..2049928 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
FSN22_RS10345 | 2049940..2050194 | - | 255 | WP_000611512.1 | phage holin | - |
FSN22_RS10350 | 2050246..2050353 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2050275..2050414 | + | 140 | NuclAT_0 | - | - |
- | 2050275..2050414 | + | 140 | NuclAT_0 | - | - |
- | 2050275..2050414 | + | 140 | NuclAT_0 | - | - |
- | 2050275..2050414 | + | 140 | NuclAT_0 | - | - |
- | 2050283..2050338 | + | 56 | - | - | Antitoxin |
FSN22_RS10355 | 2050406..2050582 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
FSN22_RS10360 | 2050732..2051028 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
FSN22_RS10365 | 2051086..2051373 | - | 288 | WP_001040261.1 | hypothetical protein | - |
FSN22_RS10370 | 2051420..2051572 | - | 153 | WP_001153681.1 | hypothetical protein | - |
FSN22_RS10375 | 2051562..2055347 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2045927..2104894 | 58967 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T135475 WP_011447039.1 NZ_CP042348:c2050582-2050406 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T135475 NZ_CP042348:c2050582-2050406 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT135475 NZ_CP042348:2050283-2050338 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|