Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1044774..1044936 | Replicon | chromosome |
Accession | NZ_CP042341 | ||
Organism | Staphylococcus capitis strain BN2 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A7Z7YYS1 |
Locus tag | FRG19_RS05025 | Protein ID | WP_049428026.1 |
Coordinates | 1044774..1044878 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1044906..1044936 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FRG19_RS05015 | 1040706..1043645 | + | 2940 | WP_194251442.1 | AAA family ATPase | - |
FRG19_RS05020 | 1043642..1044583 | + | 942 | WP_049428024.1 | 3'-5' exoribonuclease YhaM | - |
FRG19_RS05025 | 1044774..1044878 | + | 105 | WP_049428026.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1044906..1044936 | + | 31 | - | - | Antitoxin |
FRG19_RS05030 | 1045033..1046034 | - | 1002 | WP_194251443.1 | peptidylprolyl isomerase | - |
FRG19_RS05035 | 1046236..1046805 | - | 570 | WP_193626992.1 | DUF3267 domain-containing protein | - |
FRG19_RS05040 | 1046997..1047368 | - | 372 | WP_049428031.1 | YtxH domain-containing protein | - |
FRG19_RS05045 | 1047446..1047871 | - | 426 | WP_049428034.1 | HIT family protein | - |
FRG19_RS05050 | 1048004..1048744 | + | 741 | WP_002453567.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3894.63 Da Isoelectric Point: 9.5124
>T135443 WP_049428026.1 NZ_CP042341:1044774-1044878 [Staphylococcus capitis]
MLFDIFVHIMATATSGCIVALFAHWLSTRNDKRK
MLFDIFVHIMATATSGCIVALFAHWLSTRNDKRK
Download Length: 105 bp
>T135443 NZ_CP042341:1044774-1044878 [Staphylococcus capitis]
ATGTTATTTGATATCTTTGTACACATCATGGCCACGGCAACCAGTGGTTGTATCGTTGCTTTATTCGCGCATTGGCTAAG
CACTCGCAACGATAAACGTAAATAG
ATGTTATTTGATATCTTTGTACACATCATGGCCACGGCAACCAGTGGTTGTATCGTTGCTTTATTCGCGCATTGGCTAAG
CACTCGCAACGATAAACGTAAATAG
Antitoxin
Download Length: 31 bp
>AT135443 NZ_CP042341:1044906-1044936 [Staphylococcus capitis]
AAATCCCCTCACTACTGCCATAGTGAGGGGA
AAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|