Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 117022..117255 | Replicon | plasmid pCTXM-GZ04 |
| Accession | NZ_CP042337 | ||
| Organism | Escherichia coli strain GZ04-0086 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | E3B71_RS26310 | Protein ID | WP_001312861.1 |
| Coordinates | 117022..117180 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 117224..117255 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3B71_RS26275 | 112396..113085 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| E3B71_RS26280 | 113272..113655 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| E3B71_RS26285 | 113976..114578 | + | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| E3B71_RS26290 | 114875..115696 | - | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| E3B71_RS26295 | 115814..116101 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| E3B71_RS26310 | 117022..117180 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 117224..117255 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 117224..117255 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 117224..117255 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 117224..117255 | - | 32 | NuclAT_1 | - | Antitoxin |
| - | 118697..118894 | - | 198 | NuclAT_0 | - | - |
| - | 118697..118894 | - | 198 | NuclAT_0 | - | - |
| - | 118697..118894 | - | 198 | NuclAT_0 | - | - |
| - | 118697..118894 | - | 198 | NuclAT_0 | - | - |
| E3B71_RS27665 | 118706..118894 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| E3B71_RS26320 | 118906..119625 | - | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| E3B71_RS26325 | 119622..120056 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| E3B71_RS26330 | 120111..120308 | - | 198 | Protein_142 | hypothetical protein | - |
| E3B71_RS26335 | 120336..120569 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| E3B71_RS26340 | 120637..121176 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| E3B71_RS26345 | 121202..121408 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| E3B71_RS26360 | 121818..122024 | - | 207 | WP_001774176.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..159610 | 159610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T135433 WP_001312861.1 NZ_CP042337:c117180-117022 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T135433 NZ_CP042337:c117180-117022 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 32 bp
>AT135433 NZ_CP042337:c117255-117224 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|