Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2608108..2608293 | Replicon | chromosome |
Accession | NZ_CP042286 | ||
Organism | Staphylococcus argenteus strain B3-25B |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | FPV14_RS12620 | Protein ID | WP_047556148.1 |
Coordinates | 2608192..2608293 (-) | Length | 34 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2608108..2608168 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FPV14_RS12610 | 2604018..2605751 | - | 1734 | WP_047556152.1 | ABC transporter ATP-binding protein/permease | - |
FPV14_RS12615 | 2605776..2607539 | - | 1764 | WP_146501824.1 | ABC transporter ATP-binding protein/permease | - |
- | 2608108..2608168 | + | 61 | - | - | Antitoxin |
FPV14_RS12620 | 2608192..2608293 | - | 102 | WP_047556148.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
FPV14_RS12625 | 2608427..2608813 | - | 387 | WP_072467136.1 | flippase GtxA | - |
FPV14_RS12630 | 2609081..2610223 | + | 1143 | WP_047431353.1 | glycerate kinase | - |
FPV14_RS12635 | 2610282..2610941 | + | 660 | WP_000831306.1 | membrane protein | - |
FPV14_RS12640 | 2611126..2612337 | + | 1212 | WP_146501826.1 | multidrug effflux MFS transporter | - |
FPV14_RS12645 | 2612453..2612932 | - | 480 | WP_000875877.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3881.68 Da Isoelectric Point: 12.2436
>T135151 WP_047556148.1 NZ_CP042286:c2608293-2608192 [Staphylococcus argenteus]
MFNLLINIMTTAISGCLVAFFAHWLRTRNNKKR
MFNLLINIMTTAISGCLVAFFAHWLRTRNNKKR
Download Length: 102 bp
>T135151 NZ_CP042286:c2608293-2608192 [Staphylococcus argenteus]
ATGTTCAATTTATTGATTAACATCATGACTACAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAAGGTGA
ATGTTCAATTTATTGATTAACATCATGACTACAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAAGGTGA
Antitoxin
Download Length: 61 bp
>AT135151 NZ_CP042286:2608108-2608168 [Staphylococcus argenteus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|