Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2054601..2054781 | Replicon | chromosome |
| Accession | NZ_CP042286 | ||
| Organism | Staphylococcus argenteus strain B3-25B | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | FPV14_RS09685 | Protein ID | WP_001801861.1 |
| Coordinates | 2054601..2054696 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2054724..2054781 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FPV14_RS09645 | 2049661..2050656 | + | 996 | WP_072467221.1 | DUF4352 domain-containing protein | - |
| FPV14_RS09650 | 2050732..2051358 | + | 627 | WP_047556358.1 | hypothetical protein | - |
| FPV14_RS09655 | 2051399..2051740 | + | 342 | WP_047556357.1 | DUF3969 family protein | - |
| FPV14_RS09660 | 2051841..2052413 | + | 573 | WP_047556356.1 | hypothetical protein | - |
| FPV14_RS09665 | 2052610..2053167 | - | 558 | WP_047556355.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FPV14_RS09670 | 2053352..2053798 | - | 447 | WP_031787841.1 | DUF1433 domain-containing protein | - |
| FPV14_RS09675 | 2053920..2054178 | - | 259 | Protein_1872 | IS3 family transposase | - |
| FPV14_RS09680 | 2054220..2054456 | - | 237 | WP_047556353.1 | IS3 family transposase | - |
| FPV14_RS09685 | 2054601..2054696 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2054724..2054781 | - | 58 | - | - | Antitoxin |
| FPV14_RS09695 | 2055707..2056150 | - | 444 | WP_047556351.1 | DUF1433 domain-containing protein | - |
| FPV14_RS09700 | 2056150..2056592 | - | 443 | Protein_1876 | DUF1433 domain-containing protein | - |
| FPV14_RS09705 | 2056592..2057038 | - | 447 | WP_047556344.1 | DUF1433 domain-containing protein | - |
| FPV14_RS09710 | 2057038..2057481 | - | 444 | WP_047556340.1 | DUF1433 domain-containing protein | - |
| FPV14_RS09715 | 2057481..2057924 | - | 444 | WP_047556338.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2054220..2054456 | 236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T135146 WP_001801861.1 NZ_CP042286:2054601-2054696 [Staphylococcus argenteus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T135146 NZ_CP042286:2054601-2054696 [Staphylococcus argenteus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT135146 NZ_CP042286:c2054781-2054724 [Staphylococcus argenteus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|