Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2187556..2187777 Replicon chromosome
Accession NZ_CP042250
Organism Escherichia coli strain BCE049

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag FQU84_RS12620 Protein ID WP_000170954.1
Coordinates 2187556..2187663 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2187716..2187777 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FQU84_RS12595 2183401..2184483 + 1083 WP_000804726.1 peptide chain release factor 1 -
FQU84_RS12600 2184483..2185316 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
FQU84_RS12605 2185313..2185705 + 393 WP_000200375.1 invasion regulator SirB2 -
FQU84_RS12610 2185709..2186518 + 810 WP_001257054.1 invasion regulator SirB1 -
FQU84_RS12615 2186554..2187408 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FQU84_RS12620 2187556..2187663 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2187716..2187777 + 62 NuclAT_13 - Antitoxin
- 2187716..2187777 + 62 NuclAT_13 - Antitoxin
- 2187716..2187777 + 62 NuclAT_13 - Antitoxin
- 2187716..2187777 + 62 NuclAT_13 - Antitoxin
- 2187716..2187777 + 62 NuclAT_14 - Antitoxin
- 2187716..2187777 + 62 NuclAT_14 - Antitoxin
- 2187716..2187777 + 62 NuclAT_14 - Antitoxin
- 2187716..2187777 + 62 NuclAT_14 - Antitoxin
- 2187716..2187777 + 62 NuclAT_15 - Antitoxin
- 2187716..2187777 + 62 NuclAT_15 - Antitoxin
- 2187716..2187777 + 62 NuclAT_15 - Antitoxin
- 2187716..2187777 + 62 NuclAT_15 - Antitoxin
- 2187716..2187777 + 62 NuclAT_16 - Antitoxin
- 2187716..2187777 + 62 NuclAT_16 - Antitoxin
- 2187716..2187777 + 62 NuclAT_16 - Antitoxin
- 2187716..2187777 + 62 NuclAT_16 - Antitoxin
- 2187716..2187777 + 62 NuclAT_17 - Antitoxin
- 2187716..2187777 + 62 NuclAT_17 - Antitoxin
- 2187716..2187777 + 62 NuclAT_17 - Antitoxin
- 2187716..2187777 + 62 NuclAT_17 - Antitoxin
- 2187716..2187777 + 62 NuclAT_18 - Antitoxin
- 2187716..2187777 + 62 NuclAT_18 - Antitoxin
- 2187716..2187777 + 62 NuclAT_18 - Antitoxin
- 2187716..2187777 + 62 NuclAT_18 - Antitoxin
- 2187716..2187778 + 63 NuclAT_10 - -
- 2187716..2187778 + 63 NuclAT_10 - -
- 2187716..2187778 + 63 NuclAT_10 - -
- 2187716..2187778 + 63 NuclAT_10 - -
- 2187716..2187778 + 63 NuclAT_11 - -
- 2187716..2187778 + 63 NuclAT_11 - -
- 2187716..2187778 + 63 NuclAT_11 - -
- 2187716..2187778 + 63 NuclAT_11 - -
- 2187716..2187778 + 63 NuclAT_12 - -
- 2187716..2187778 + 63 NuclAT_12 - -
- 2187716..2187778 + 63 NuclAT_12 - -
- 2187716..2187778 + 63 NuclAT_12 - -
- 2187716..2187778 + 63 NuclAT_7 - -
- 2187716..2187778 + 63 NuclAT_7 - -
- 2187716..2187778 + 63 NuclAT_7 - -
- 2187716..2187778 + 63 NuclAT_7 - -
- 2187716..2187778 + 63 NuclAT_8 - -
- 2187716..2187778 + 63 NuclAT_8 - -
- 2187716..2187778 + 63 NuclAT_8 - -
- 2187716..2187778 + 63 NuclAT_8 - -
- 2187716..2187778 + 63 NuclAT_9 - -
- 2187716..2187778 + 63 NuclAT_9 - -
- 2187716..2187778 + 63 NuclAT_9 - -
- 2187716..2187778 + 63 NuclAT_9 - -
- 2187716..2187779 + 64 NuclAT_19 - -
- 2187716..2187779 + 64 NuclAT_19 - -
- 2187716..2187779 + 64 NuclAT_19 - -
- 2187716..2187779 + 64 NuclAT_19 - -
- 2187716..2187779 + 64 NuclAT_20 - -
- 2187716..2187779 + 64 NuclAT_20 - -
- 2187716..2187779 + 64 NuclAT_20 - -
- 2187716..2187779 + 64 NuclAT_20 - -
- 2187716..2187779 + 64 NuclAT_21 - -
- 2187716..2187779 + 64 NuclAT_21 - -
- 2187716..2187779 + 64 NuclAT_21 - -
- 2187716..2187779 + 64 NuclAT_21 - -
- 2187716..2187779 + 64 NuclAT_22 - -
- 2187716..2187779 + 64 NuclAT_22 - -
- 2187716..2187779 + 64 NuclAT_22 - -
- 2187716..2187779 + 64 NuclAT_22 - -
- 2187716..2187779 + 64 NuclAT_23 - -
- 2187716..2187779 + 64 NuclAT_23 - -
- 2187716..2187779 + 64 NuclAT_23 - -
- 2187716..2187779 + 64 NuclAT_23 - -
- 2187716..2187779 + 64 NuclAT_24 - -
- 2187716..2187779 + 64 NuclAT_24 - -
- 2187716..2187779 + 64 NuclAT_24 - -
- 2187716..2187779 + 64 NuclAT_24 - -
FQU84_RS12630 2188069..2189169 - 1101 WP_001313768.1 sodium-potassium/proton antiporter ChaA -
FQU84_RS12635 2189439..2189669 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FQU84_RS12640 2189827..2190522 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
FQU84_RS12645 2190566..2190919 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
FQU84_RS12650 2191104..2192498 + 1395 WP_000086194.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T135086 WP_000170954.1 NZ_CP042250:c2187663-2187556 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T135086 NZ_CP042250:c2187663-2187556 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT135086 NZ_CP042250:2187716-2187777 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References