Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 326063..326257 | Replicon | chromosome |
Accession | NZ_CP042216 | ||
Organism | Enterococcus faecalis strain L8 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | FOA09_RS01630 | Protein ID | WP_015543884.1 |
Coordinates | 326162..326257 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 326063..326127 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FOA09_RS01615 | 321681..323423 | + | 1743 | WP_016627729.1 | PTS transporter subunit EIIC | - |
FOA09_RS01620 | 323414..325447 | + | 2034 | WP_002361171.1 | transcription antiterminator | - |
FOA09_RS01625 | 325458..325892 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 326063..326127 | + | 65 | NuclAT_12 | - | Antitoxin |
FOA09_RS01630 | 326162..326257 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
FOA09_RS01635 | 326503..328275 | + | 1773 | WP_010819728.1 | PTS mannitol transporter subunit IICBA | - |
FOA09_RS01640 | 328290..328727 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
FOA09_RS01645 | 328742..329896 | + | 1155 | WP_016627726.1 | mannitol-1-phosphate 5-dehydrogenase | - |
FOA09_RS01650 | 329964..331079 | - | 1116 | WP_016627725.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T134976 WP_015543884.1 NZ_CP042216:c326257-326162 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T134976 NZ_CP042216:c326257-326162 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT134976 NZ_CP042216:326063-326127 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|