Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 210485..210682 | Replicon | chromosome |
Accession | NZ_CP042157 | ||
Organism | Staphylococcus aureus strain B3-17D |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | FP481_RS01200 | Protein ID | WP_001802298.1 |
Coordinates | 210578..210682 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 210485..210523 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FP481_RS01180 | 206672..207337 | - | 666 | WP_001024092.1 | SDR family oxidoreductase | - |
FP481_RS01185 | 207489..207809 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
FP481_RS01190 | 207811..208788 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
FP481_RS01195 | 209054..210145 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
- | 210485..210523 | + | 39 | - | - | Antitoxin |
FP481_RS01200 | 210578..210682 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
FP481_RS01210 | 211362..211520 | + | 159 | WP_001792784.1 | hypothetical protein | - |
FP481_RS01220 | 212178..213035 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
FP481_RS01225 | 213103..213885 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T134909 WP_001802298.1 NZ_CP042157:c210682-210578 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T134909 NZ_CP042157:c210682-210578 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT134909 NZ_CP042157:210485-210523 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|