Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2251397..2251594 | Replicon | chromosome |
Accession | NZ_CP042153 | ||
Organism | Staphylococcus aureus strain B4-59C |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | FP482_RS11300 | Protein ID | WP_001802298.1 |
Coordinates | 2251490..2251594 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2251397..2251435 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FP482_RS11280 | 2247584..2248249 | - | 666 | WP_001024092.1 | SDR family oxidoreductase | - |
FP482_RS11285 | 2248401..2248721 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
FP482_RS11290 | 2248723..2249700 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
FP482_RS11295 | 2249966..2251057 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
- | 2251397..2251435 | + | 39 | - | - | Antitoxin |
FP482_RS11300 | 2251490..2251594 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
FP482_RS11310 | 2252274..2252432 | + | 159 | WP_001792784.1 | hypothetical protein | - |
FP482_RS11320 | 2253090..2253947 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
FP482_RS11325 | 2254015..2254797 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T134897 WP_001802298.1 NZ_CP042153:c2251594-2251490 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T134897 NZ_CP042153:c2251594-2251490 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT134897 NZ_CP042153:2251397-2251435 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|