Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 257606..257790 | Replicon | chromosome |
Accession | NZ_CP042107 | ||
Organism | Staphylococcus aureus strain B8-13D |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | FP484_RS01395 | Protein ID | WP_000482652.1 |
Coordinates | 257683..257790 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 257606..257666 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FP484_RS01380 | 253061..253228 | - | 168 | Protein_271 | hypothetical protein | - |
FP484_RS01385 | 253459..255192 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
FP484_RS01390 | 255217..256980 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 257606..257666 | + | 61 | - | - | Antitoxin |
FP484_RS01395 | 257683..257790 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
FP484_RS01400 | 257924..258310 | - | 387 | WP_000779360.1 | flippase GtxA | - |
FP484_RS01405 | 258578..259720 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
FP484_RS01410 | 259780..260439 | + | 660 | WP_000831298.1 | membrane protein | - |
FP484_RS01415 | 260621..261832 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
FP484_RS01420 | 261955..262428 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T134872 WP_000482652.1 NZ_CP042107:c257790-257683 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T134872 NZ_CP042107:c257790-257683 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT134872 NZ_CP042107:257606-257666 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|