Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2445241..2445438 | Replicon | chromosome |
Accession | NZ_CP042043 | ||
Organism | Staphylococcus aureus strain B2-15A |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | FP478_RS12355 | Protein ID | WP_001802298.1 |
Coordinates | 2445334..2445438 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2445241..2445279 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FP478_RS12335 | 2441428..2442093 | - | 666 | WP_001024092.1 | SDR family oxidoreductase | - |
FP478_RS12340 | 2442245..2442565 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
FP478_RS12345 | 2442567..2443544 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
FP478_RS12350 | 2443810..2444901 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
- | 2445241..2445279 | + | 39 | - | - | Antitoxin |
FP478_RS12355 | 2445334..2445438 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
FP478_RS12365 | 2446118..2446276 | + | 159 | WP_001792784.1 | hypothetical protein | - |
FP478_RS12375 | 2446934..2447791 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
FP478_RS12380 | 2447859..2448641 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T134856 WP_001802298.1 NZ_CP042043:c2445438-2445334 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T134856 NZ_CP042043:c2445438-2445334 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT134856 NZ_CP042043:2445241-2445279 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|