Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2101882..2102062 | Replicon | chromosome |
Accession | NZ_CP042043 | ||
Organism | Staphylococcus aureus strain B2-15A |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | FP478_RS10300 | Protein ID | WP_001801861.1 |
Coordinates | 2101882..2101977 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2102005..2102062 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FP478_RS10270 | 2097045..2097695 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
FP478_RS10275 | 2097776..2098771 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
FP478_RS10280 | 2098846..2099472 | + | 627 | WP_000669024.1 | hypothetical protein | - |
FP478_RS10285 | 2099513..2099854 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
FP478_RS10290 | 2099955..2100527 | + | 573 | WP_000414216.1 | hypothetical protein | - |
FP478_RS10295 | 2100725..2101737 | - | 1013 | Protein_1989 | IS3 family transposase | - |
FP478_RS10300 | 2101882..2101977 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2102005..2102062 | - | 58 | - | - | Antitoxin |
FP478_RS10305 | 2102100..2102201 | + | 102 | WP_001792025.1 | hypothetical protein | - |
FP478_RS10310 | 2102179..2102340 | - | 162 | Protein_1992 | transposase | - |
FP478_RS10315 | 2102331..2102825 | - | 495 | Protein_1993 | transposase | - |
FP478_RS10320 | 2103277..2104506 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
FP478_RS10325 | 2104499..2106055 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
FP478_RS10330 | 2106219..2106353 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 2096287..2148294 | 52007 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T134847 WP_001801861.1 NZ_CP042043:2101882-2101977 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T134847 NZ_CP042043:2101882-2101977 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT134847 NZ_CP042043:c2102062-2102005 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|