Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 817444..817723 | Replicon | chromosome |
Accession | NZ_CP042003 | ||
Organism | Staphylococcus aureus strain B3-14B |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | FP480_RS03940 | Protein ID | WP_001802298.1 |
Coordinates | 817444..817548 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 817544..817723 (-) |
Genomic Context
Location: 813343..813951 (609 bp)
Type: Others
Protein ID: WP_000101714.1
Type: Others
Protein ID: WP_000101714.1
Location: 814241..815023 (783 bp)
Type: Others
Protein ID: WP_000908191.1
Type: Others
Protein ID: WP_000908191.1
Location: 815091..815948 (858 bp)
Type: Others
Protein ID: WP_000370942.1
Type: Others
Protein ID: WP_000370942.1
Location: 817444..817548 (105 bp)
Type: Toxin
Protein ID: WP_001802298.1
Type: Toxin
Protein ID: WP_001802298.1
Location: 820857..821522 (666 bp)
Type: Others
Protein ID: WP_001024099.1
Type: Others
Protein ID: WP_001024099.1
Location: 816078..816170 (93 bp)
Type: Others
Protein ID: WP_000220902.1
Type: Others
Protein ID: WP_000220902.1
Location: 816606..816764 (159 bp)
Type: Others
Protein ID: WP_001792784.1
Type: Others
Protein ID: WP_001792784.1
Location: 816757..816927 (171 bp)
Type: Others
Protein ID: WP_001807897.1
Type: Others
Protein ID: WP_001807897.1
Location: 817544..817723 (180 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 818046..819137 (1092 bp)
Type: Others
Protein ID: WP_000495673.1
Type: Others
Protein ID: WP_000495673.1
Location: 819403..820383 (981 bp)
Type: Others
Protein ID: WP_000019735.1
Type: Others
Protein ID: WP_000019735.1
Location: 820385..820705 (321 bp)
Type: Others
Protein ID: WP_000003759.1
Type: Others
Protein ID: WP_000003759.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FP480_RS03905 | 813343..813951 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
FP480_RS03910 | 814241..815023 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
FP480_RS03915 | 815091..815948 | + | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
FP480_RS03920 | 816078..816170 | - | 93 | WP_000220902.1 | hypothetical protein | - |
FP480_RS03925 | 816606..816764 | - | 159 | WP_001792784.1 | hypothetical protein | - |
FP480_RS14855 | 816757..816927 | - | 171 | WP_001807897.1 | hypothetical protein | - |
FP480_RS03940 | 817444..817548 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 817544..817723 | - | 180 | - | - | Antitoxin |
FP480_RS03945 | 818046..819137 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
FP480_RS03950 | 819403..820383 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
FP480_RS03955 | 820385..820705 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
FP480_RS03960 | 820857..821522 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T134831 WP_001802298.1 NZ_CP042003:817444-817548 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T134831 NZ_CP042003:817444-817548 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 180 bp
>AT134831 NZ_CP042003:c817723-817544 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I7Y9L9 |