Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 34686..34955 | Replicon | plasmid pKP2_2 |
| Accession | NZ_CP041948 | ||
| Organism | Klebsiella pneumoniae strain KP2 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | FOZ68_RS26615 | Protein ID | WP_001312861.1 |
| Coordinates | 34797..34955 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 34686..34751 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOZ68_RS26590 | 30396..30923 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| FOZ68_RS26595 | 30981..31214 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| FOZ68_RS26600 | 31275..33298 | + | 2024 | Protein_39 | ParB/RepB/Spo0J family partition protein | - |
| FOZ68_RS26605 | 33367..33801 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| FOZ68_RS26610 | 33798..34517 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 34529..34753 | + | 225 | NuclAT_0 | - | - |
| - | 34529..34753 | + | 225 | NuclAT_0 | - | - |
| - | 34529..34753 | + | 225 | NuclAT_0 | - | - |
| - | 34529..34753 | + | 225 | NuclAT_0 | - | - |
| - | 34686..34751 | + | 66 | - | - | Antitoxin |
| FOZ68_RS26615 | 34797..34955 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| FOZ68_RS28835 | 35193..35570 | - | 378 | Protein_43 | hypothetical protein | - |
| FOZ68_RS26625 | 35870..36166 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| FOZ68_RS26630 | 36277..37098 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| FOZ68_RS26635 | 37395..37997 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| FOZ68_RS26640 | 38320..38703 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| FOZ68_RS26645 | 38897..39568 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| FOZ68_RS26650 | 39705..39932 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaNDM-5 / dfrA12 | - | 1..75307 | 75307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T134717 WP_001312861.1 NZ_CP041948:34797-34955 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T134717 NZ_CP041948:34797-34955 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT134717 NZ_CP041948:34686-34751 [Klebsiella pneumoniae]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|