Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 46741..46993 | Replicon | plasmid p1 |
| Accession | NZ_CP041739 | ||
| Organism | Enterococcus faecalis EnGen0107 strain B594 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | SAW_RS16890 | Protein ID | WP_107164701.1 |
| Coordinates | 46741..46851 (+) | Length | 37 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 46891..46993 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAW_RS16850 | 42661..43281 | + | 621 | WP_021732893.1 | recombinase family protein | - |
| SAW_RS16855 | 43298..43585 | + | 288 | WP_010708491.1 | hypothetical protein | - |
| SAW_RS16860 | 43579..43803 | + | 225 | WP_010714310.1 | hypothetical protein | - |
| SAW_RS16865 | 43864..44073 | + | 210 | WP_002393768.1 | hypothetical protein | - |
| SAW_RS16870 | 44085..44387 | + | 303 | WP_002393766.1 | hypothetical protein | - |
| SAW_RS16875 | 44815..46143 | + | 1329 | WP_010714311.1 | Y-family DNA polymerase | - |
| SAW_RS16880 | 46140..46490 | + | 351 | WP_002365943.1 | hypothetical protein | - |
| SAW_RS16890 | 46741..46851 | + | 111 | WP_107164701.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 46891..46993 | - | 103 | NuclAT_0 | - | Antitoxin |
| - | 46891..46993 | - | 103 | NuclAT_0 | - | Antitoxin |
| - | 46891..46993 | - | 103 | NuclAT_0 | - | Antitoxin |
| - | 46891..46993 | - | 103 | NuclAT_0 | - | Antitoxin |
| SAW_RS16895 | 47180..48358 | - | 1179 | WP_000997695.1 | IS256-like element ISEf1 family transposase | - |
| SAW_RS16900 | 48536..48997 | + | 462 | WP_002365946.1 | hypothetical protein | - |
| SAW_RS17455 | 49168..49458 | + | 291 | WP_002365947.1 | hypothetical protein | - |
| SAW_RS16910 | 49562..49933 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
| SAW_RS16915 | 49926..50771 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | asa1 | 1..70182 | 70182 | |
| - | flank | IS/Tn | - | - | 47180..48358 | 1178 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4090.89 Da Isoelectric Point: 4.1672
>T129114 WP_107164701.1 NZ_CP041739:46741-46851 [Enterococcus faecalis EnGen0107]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 111 bp
>T129114 NZ_CP041739:46741-46851 [Enterococcus faecalis EnGen0107]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
Antitoxin
Download Length: 103 bp
>AT129114 NZ_CP041739:c46993-46891 [Enterococcus faecalis EnGen0107]
TTGACCCAAAATAAAAATATGCTATACTAAAAGTGCGAAACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTAC
GGCGAATAGGATTGCTTTTTTTT
TTGACCCAAAATAAAAATATGCTATACTAAAAGTGCGAAACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTAC
GGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|