Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 346287..346481 | Replicon | chromosome |
Accession | NZ_CP041738 | ||
Organism | Enterococcus faecalis EnGen0107 strain B594 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | SAW_RS17325 | Protein ID | WP_015543884.1 |
Coordinates | 346386..346481 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 346287..346351 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAW_RS01935 | 341920..343662 | + | 1743 | WP_010714204.1 | PTS transporter subunit EIIC | - |
SAW_RS01940 | 343653..345686 | + | 2034 | WP_002387671.1 | transcription antiterminator | - |
SAW_RS01945 | 345697..346131 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 346287..346351 | + | 65 | - | - | Antitoxin |
SAW_RS17325 | 346386..346481 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAW_RS01955 | 346727..348499 | + | 1773 | WP_010706745.1 | PTS mannitol transporter subunit IICBA | - |
SAW_RS01960 | 348514..348951 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
SAW_RS01965 | 348966..350120 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
SAW_RS01970 | 350187..351302 | - | 1116 | WP_002379062.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T129086 WP_015543884.1 NZ_CP041738:c346481-346386 [Enterococcus faecalis EnGen0107]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T129086 NZ_CP041738:c346481-346386 [Enterococcus faecalis EnGen0107]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT129086 NZ_CP041738:346287-346351 [Enterococcus faecalis EnGen0107]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|