Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrG-as-bsrG/- |
Location | 2101655..2101905 | Replicon | chromosome |
Accession | NZ_CP041693 | ||
Organism | Bacillus amyloliquefaciens strain H |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | FOG69_RS10705 | Protein ID | WP_009967548.1 |
Coordinates | 2101655..2101771 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 2101766..2101905 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FOG69_RS10675 | 2096792..2097052 | + | 261 | WP_014472510.1 | hypothetical protein | - |
FOG69_RS10680 | 2097204..2098366 | + | 1163 | Protein_2057 | tetratricopeptide repeat protein | - |
FOG69_RS10685 | 2098530..2099780 | - | 1251 | WP_014470073.1 | UV-damage repair protein uvrX | - |
FOG69_RS10690 | 2099773..2100105 | - | 333 | WP_014470072.1 | YolD-like family protein | - |
FOG69_RS10695 | 2100324..2100988 | - | 665 | Protein_2060 | sporulation protein YunB | - |
FOG69_RS10700 | 2101223..2101426 | - | 204 | WP_014470071.1 | hypothetical protein | - |
FOG69_RS10705 | 2101655..2101771 | + | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
- | 2101766..2101905 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2101766..2101905 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2101766..2101905 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2101766..2101905 | - | 140 | NuclAT_0 | - | Antitoxin |
FOG69_RS10710 | 2102079..2102537 | - | 459 | WP_014470070.1 | SMI1/KNR4 family protein | - |
FOG69_RS10715 | 2102550..2104436 | - | 1887 | WP_014470069.1 | HNH endonuclease | - |
FOG69_RS10720 | 2104943..2105713 | + | 771 | WP_014470068.1 | hypothetical protein | - |
FOG69_RS10725 | 2105757..2106191 | - | 435 | WP_076982859.1 | SMI1/KNR4 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1971172..2109227 | 138055 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T129014 WP_009967548.1 NZ_CP041693:2101655-2101771 [Bacillus amyloliquefaciens]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
>T129014 NZ_CP041693:2101655-2101771 [Bacillus amyloliquefaciens]
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
ATGACTGTTTACGAATCATTAATGATAATGATCAATTTTGGCGGATTGATATTAAATACCGTCTTGTTGATCTTCAATAT
AATGATGATTGTAACGTCAAGCCAAAAGAAAAAATAG
Antitoxin
Download Length: 140 bp
>AT129014 NZ_CP041693:c2101905-2101766 [Bacillus amyloliquefaciens]
AAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCACCCCGGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCG
ATGTTGAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTT
AAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCACCCCGGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCG
ATGTTGAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|